(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE80

PENCW_13.PE80        Location/Qualifiers
FT   CDS             join(complement(186750..187189),complement(185365..186688),
FT                   complement(184497..185313),complement(183143..184445),
FT                   complement(182730..183072),complement(182527..182670))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946583"
FT                   /orf_name="Pc16g00800"
FT                   /product="Pc16g00800 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP92750.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0001831314"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y3"
FT                   /transl_table=1
FT                   /translation="MPAPLHPHLKHTSSFATEKHNNEPPRVQVSHEDEDALADIHQTLT
FT                   AQTQPDPKYPEPHSSFDKFLEEQVQGKKPANLGVCFQSLSTWGDGDSHADVKTFSTALW
FT                   RTLTLQDIYEWTIQPWIAKKKPEEGRPLIRDFSGVVQSGEIMLVLGRPGAGCSTFLRTI
FT                   AGHHSSFLGVTGSIDYSGLSPDEVRKHYRGAVAYVPEDDVHFPTLTVRQTLEFALQSKT
FT                   PKRYRERIPRYLEIYGRVFGMSHTMNTLVGNEYIRGVSGGERKRISIIESLATDSSVAC
FT                   WDNSTRGLDASSALDYARSLRIMTDTCGKATLLTLYQASDAIYELVDKVLLIDEGRMLY
FT                   QGPANEAKRYFEDLGYECADMQTTSDFLTSITLPERRRFRAGWEHRAPKGPIELEAAFR
FT                   QSAAFSKIETDVESYEDQKLTGRSSAYPADSECDSVEVFKNTVHSDKSRFVSSKSPYTI
FT                   SLFRQVVLCAKRQMWQLKGHLGPLYVKLISCVVYGLLIGSMFYDQPQTTEGMYSRGGVL
FT                   FYSSILLAWLQMSELEEAMQGRDILSRQKKFAFVRPSAVCLARVLSDMVITAVLTFLYL
FT                   IVMYFLSGLRSDAGPFFIDALFIYACTVCLTAQFRVFAALSQNFEVALRYCGVSVMFCI
FT                   VFGGYVLSVDKMIQDVPWVGWLAYTTPALYTYEAVMAAEFHNVNFTCAAASIIPSGSEY
FT                   TDLAYQTCAYAGSQIGSTVVNGDDYLAVKYGFYYSNVWRNFGILCLFTVAFIGITCWLS
FT                   EVLEWELDSAGPIQYKGSRKLFKREKKVQSDEEKSPVSVDSSAPPAGHETKHDQTLTAT
FT                   ESTFSWSDLELNVQIGKETRKLLDGVCGYCKPGSLTALVGASGAGKSTLLTALTQRESP
FT                   GTLSGSLFVDNRSIDQSFNRQIGYCQQMDIHDESSTIKEALQFSALLRQSREVPTAEKL
FT                   AYVETVIHTLDLVELQDAVIGSLDIEKKKRVTIGVELCARPKLLLFLDEPTSGLDSQGA
FT                   TSIVALLRRLANQGLAVLCTIHQANQQQFEEVSATHSDQESILTGSQFDRVLALSPGGS
FT                   TYYFGPVGESGHAIFEYFARHGNVPENVTNAADFLIEVVVGGMKASGNQTNWPAIWRNS
FT                   EEFAEVKNEIASIRSDKNTRSPSLAPTPPPISQQIKLLTQRTCRQFWRTAEYPYSRLYS
FT                   SFLHALINGLTYLQIGNSTTDLQSKAFSCFLVLMLVPEFINAISMRFILNRDIWLAREG
FT                   PSGVYGWVAFCTAQIISEIPYSVIGGVVFFVLYYFMVGLPLGFAAGYCFLMFFLFFLFA
FT                   TSWGQWIAALSSDSMIAATLMPFFIIMCELFNGILRPQSQMPAFWKYTMYYATPFTYWI
FT                   GGVLTSVLRGTPVVCSQSELTIFESPPNTTCSEYADAWLNAKGVGYLSNPDGMGECGYC
FT                   EYSFGDDYLTGLGLDSSKIWPYFGIFLAFTITNYLMVYLLVYVRSVMKPFWRSK"
     MPAPLHPHLK HTSSFATEKH NNEPPRVQVS HEDEDALADI HQTLTAQTQP DPKYPEPHSS        60
     FDKFLEEQVQ GKKPANLGVC FQSLSTWGDG DSHADVKTFS TALWRTLTLQ DIYEWTIQPW       120
     IAKKKPEEGR PLIRDFSGVV QSGEIMLVLG RPGAGCSTFL RTIAGHHSSF LGVTGSIDYS       180
     GLSPDEVRKH YRGAVAYVPE DDVHFPTLTV RQTLEFALQS KTPKRYRERI PRYLEIYGRV       240
     FGMSHTMNTL VGNEYIRGVS GGERKRISII ESLATDSSVA CWDNSTRGLD ASSALDYARS       300
     LRIMTDTCGK ATLLTLYQAS DAIYELVDKV LLIDEGRMLY QGPANEAKRY FEDLGYECAD       360
     MQTTSDFLTS ITLPERRRFR AGWEHRAPKG PIELEAAFRQ SAAFSKIETD VESYEDQKLT       420
     GRSSAYPADS ECDSVEVFKN TVHSDKSRFV SSKSPYTISL FRQVVLCAKR QMWQLKGHLG       480
     PLYVKLISCV VYGLLIGSMF YDQPQTTEGM YSRGGVLFYS SILLAWLQMS ELEEAMQGRD       540
     ILSRQKKFAF VRPSAVCLAR VLSDMVITAV LTFLYLIVMY FLSGLRSDAG PFFIDALFIY       600
     ACTVCLTAQF RVFAALSQNF EVALRYCGVS VMFCIVFGGY VLSVDKMIQD VPWVGWLAYT       660
     TPALYTYEAV MAAEFHNVNF TCAAASIIPS GSEYTDLAYQ TCAYAGSQIG STVVNGDDYL       720
     AVKYGFYYSN VWRNFGILCL FTVAFIGITC WLSEVLEWEL DSAGPIQYKG SRKLFKREKK       780
     VQSDEEKSPV SVDSSAPPAG HETKHDQTLT ATESTFSWSD LELNVQIGKE TRKLLDGVCG       840
     YCKPGSLTAL VGASGAGKST LLTALTQRES PGTLSGSLFV DNRSIDQSFN RQIGYCQQMD       900
     IHDESSTIKE ALQFSALLRQ SREVPTAEKL AYVETVIHTL DLVELQDAVI GSLDIEKKKR       960
     VTIGVELCAR PKLLLFLDEP TSGLDSQGAT SIVALLRRLA NQGLAVLCTI HQANQQQFEE      1020
     VSATHSDQES ILTGSQFDRV LALSPGGSTY YFGPVGESGH AIFEYFARHG NVPENVTNAA      1080
     DFLIEVVVGG MKASGNQTNW PAIWRNSEEF AEVKNEIASI RSDKNTRSPS LAPTPPPISQ      1140
     QIKLLTQRTC RQFWRTAEYP YSRLYSSFLH ALINGLTYLQ IGNSTTDLQS KAFSCFLVLM      1200
     LVPEFINAIS MRFILNRDIW LAREGPSGVY GWVAFCTAQI ISEIPYSVIG GVVFFVLYYF      1260
     MVGLPLGFAA GYCFLMFFLF FLFATSWGQW IAALSSDSMI AATLMPFFII MCELFNGILR      1320
     PQSQMPAFWK YTMYYATPFT YWIGGVLTSV LRGTPVVCSQ SELTIFESPP NTTCSEYADA      1380
     WLNAKGVGYL SNPDGMGECG YCEYSFGDDY LTGLGLDSSK IWPYFGIFLA FTITNYLMVY      1440
     LLVYVRSVMK PFWRSK                                                      1456
//

If you have problems or comments...

PBIL Back to PBIL home page