(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE81

PENCW_13.PE81        Location/Qualifiers
FT   CDS             join(complement(188550..188693),complement(188422..188520),
FT                   complement(188202..188352),complement(188047..188124),
FT                   complement(187806..187857),complement(187719..187751),
FT                   complement(187665..187689))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946584"
FT                   /orf_name="Pc16g00810"
FT                   /product="Putative uncharacterized protein Pc16g00810 "
FT                   /protein_id="CAP92751.1"
FT                   /db_xref="UniParc:UPI0001831315"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y4"
FT                   /transl_table=1
FT                   /translation="MAPNSLTLSTSSSPTARPNSFPSFFSPFRFPVPCFPRPSSSSSTT
FT                   PGLSTHNIYPALHRVLPALHVHDPWTSTGAQEDGALSVIEGLHFAEEERGEGEEGKFEA
FT                   ETRSLELGALNWIGKLSWDIILEMRELELLCIICTEEKKTDILLSYHRHLRHQCIRICH
FT                   GRIRVECSISRLLRLASTYLATPYSVNYTG"
     MAPNSLTLST SSSPTARPNS FPSFFSPFRF PVPCFPRPSS SSSTTPGLST HNIYPALHRV        60
     LPALHVHDPW TSTGAQEDGA LSVIEGLHFA EEERGEGEEG KFEAETRSLE LGALNWIGKL       120
     SWDIILEMRE LELLCIICTE EKKTDILLSY HRHLRHQCIR ICHGRIRVEC SISRLLRLAS       180
     TYLATPYSVN YTG                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page