(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE82

PENCW_13.PE82        Location/Qualifiers
FT   CDS             join(complement(189752..190220),complement(189043..189683),
FT                   complement(188951..188989))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946585"
FT                   /orf_name="Pc16g00820"
FT                   /product="Pc16g00820 protein"
FT                   /protein_id="CAP92752.1"
FT                   /db_xref="UniParc:UPI0001831316"
FT                   /db_xref="UniProtKB/TrEMBL:B6H700"
FT                   /transl_table=1
FT                   /translation="MPPNKPTFPYRRSSNASEDDFFDIPDEPCLSIVKRQLRHVRTWIA
FT                   VALIILFILWQRRERPPPPPLPHIHYDEVDWSRFAYTQYATNEVYMCNCLMVFEALHRL
FT                   GSKADRVLFYPEEWDLIVEDDYDRVSQLLLEAKLKYNVMLIPIKIEGVQDPSTAGSRAS
FT                   WDTSTAKLMAFGEHEYDRVIHLDSDVILLQTMDELFFLPPTTAAMPRAYWLLPEKLLSS
FT                   LLVVIEPSLREYLALTDATTLAQNGQVDMNLTDHRYDMELLNRRYGDSAMVLPHRQYGL
FT                   LSGEFRKKDHRNFLGNDDEVWDPDHVLAQAKFVHFSDWPLPKPWIMWPQEMLAEEQPKC
FT                   DNNPGTPQESGCRDREIWKMLYDKYRRQRKDVCKLLSYPAPV"
     MPPNKPTFPY RRSSNASEDD FFDIPDEPCL SIVKRQLRHV RTWIAVALII LFILWQRRER        60
     PPPPPLPHIH YDEVDWSRFA YTQYATNEVY MCNCLMVFEA LHRLGSKADR VLFYPEEWDL       120
     IVEDDYDRVS QLLLEAKLKY NVMLIPIKIE GVQDPSTAGS RASWDTSTAK LMAFGEHEYD       180
     RVIHLDSDVI LLQTMDELFF LPPTTAAMPR AYWLLPEKLL SSLLVVIEPS LREYLALTDA       240
     TTLAQNGQVD MNLTDHRYDM ELLNRRYGDS AMVLPHRQYG LLSGEFRKKD HRNFLGNDDE       300
     VWDPDHVLAQ AKFVHFSDWP LPKPWIMWPQ EMLAEEQPKC DNNPGTPQES GCRDREIWKM       360
     LYDKYRRQRK DVCKLLSYPA PV                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page