(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE83

PENCW_13.PE83        Location/Qualifiers
FT   CDS             join(complement(193534..193573),complement(193440..193465),
FT                   complement(193209..193381),complement(192887..193157),
FT                   complement(192731..192839),complement(192461..192675),
FT                   complement(192339..192406),complement(191856..192267),
FT                   complement(191452..191568))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048500" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128402"
FT                   /orf_name="Pc16g00830"
FT                   /product="Pc16g00830 protein"
FT                   /protein_id="CAP92753.1"
FT                   /db_xref="UniParc:UPI0001831317"
FT                   /db_xref="UniProtKB/TrEMBL:B6H701"
FT                   /transl_table=1
FT                   /translation="MDIPNPGEGDVNIGTSTFQACWILTAIVGVALLFRYAIKIWVRWA
FT                   LPEVTAPGRIWGTEDLLFFVAWGFDITHMVFIQMSANWGLGRHFFYLTAEERLNSMKWD
FT                   FLSQPLAVASAMVSRAGMMWFLLTCFAASDKKIRLSIIICAVVQVVVNMVTIVQIIVQC
FT                   GPNPYQTTNRVQYFHYMWTPLPEDGSVKCQSPTVQTTVGFVQGGFNTVIDYFLAVLAAV
FT                   ELWQFFLRTLHRNPETSFWSQFCKISATVRSRRIWQTITLSGPLILSGCASIVKTYKLK
FT                   SLGDRHDFTYNIVTFVLWVNILLASCAPVARLFLRSFVDHRREGRTHGYWSRSRSTDHK
FT                   EPETELKRRANAKEQWLDSATATNMTITCAHDEENPPTGWSEHGHERSISQVSKAEMPE
FT                   HIDDGRVTVKTDIVVQIDDGRSISSGGTRLLPDGGESHSYRAPVNDTQQAANSVYMIIS
FT                   DQARLLSSSSLWAKGVIE"
     MDIPNPGEGD VNIGTSTFQA CWILTAIVGV ALLFRYAIKI WVRWALPEVT APGRIWGTED        60
     LLFFVAWGFD ITHMVFIQMS ANWGLGRHFF YLTAEERLNS MKWDFLSQPL AVASAMVSRA       120
     GMMWFLLTCF AASDKKIRLS IIICAVVQVV VNMVTIVQII VQCGPNPYQT TNRVQYFHYM       180
     WTPLPEDGSV KCQSPTVQTT VGFVQGGFNT VIDYFLAVLA AVELWQFFLR TLHRNPETSF       240
     WSQFCKISAT VRSRRIWQTI TLSGPLILSG CASIVKTYKL KSLGDRHDFT YNIVTFVLWV       300
     NILLASCAPV ARLFLRSFVD HRREGRTHGY WSRSRSTDHK EPETELKRRA NAKEQWLDSA       360
     TATNMTITCA HDEENPPTGW SEHGHERSIS QVSKAEMPEH IDDGRVTVKT DIVVQIDDGR       420
     SISSGGTRLL PDGGESHSYR APVNDTQQAA NSVYMIISDQ ARLLSSSSLW AKGVIE           476
//

If you have problems or comments...

PBIL Back to PBIL home page