(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE84

PENCW_13.PE84        Location/Qualifiers
FT   CDS             join(complement(195792..195887),complement(195594..195741),
FT                   complement(195526..195540),complement(195334..195460),
FT                   complement(194477..195257))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216830" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946586"
FT                   /orf_name="Pc16g00840"
FT                   /product="Pc16g00840 protein"
FT                   /function="O-methyltransferase activity"
FT                   /protein_id="CAP92754.1"
FT                   /db_xref="GO:0008171"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="UniParc:UPI0001831318"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z8"
FT                   /transl_table=1
FT                   /translation="MPLLTRLASLLGLSSPAPAVPPGAALAATVTVPASLGFVPVAIHF
FT                   DLFNILVSHGGPATADEISATCNARIKARGENEPELSTRLASDTLYIMAGLGLVERVAE
FT                   DCFTANAITNHMVAMPSAQHGALHFTTEGLMAGAFLMKKLQDTRFAYPFADADGPLQYA
FT                   YRLMGQPELAEQHTYSIMETQGRMDSFNHFMVGKFLKFGTFPERVKSMGYDLDAALAGD
FT                   NSTGTRTGSATMVDIGGGRGELLLEVQAMYPHLGAEDLIVQEFNADIDSVPGVRLMEWN
FT                   YKEQDEQPVRGACVYALQHILHNLPDLDAVALLQKISRAMAPGSRVLIIEYAKNLNYTS
FT                   LHASMIALFGGRERSSVEWRQMAGLCGLQVTFEVYVRAGESLVEMRRK"
     MPLLTRLASL LGLSSPAPAV PPGAALAATV TVPASLGFVP VAIHFDLFNI LVSHGGPATA        60
     DEISATCNAR IKARGENEPE LSTRLASDTL YIMAGLGLVE RVAEDCFTAN AITNHMVAMP       120
     SAQHGALHFT TEGLMAGAFL MKKLQDTRFA YPFADADGPL QYAYRLMGQP ELAEQHTYSI       180
     METQGRMDSF NHFMVGKFLK FGTFPERVKS MGYDLDAALA GDNSTGTRTG SATMVDIGGG       240
     RGELLLEVQA MYPHLGAEDL IVQEFNADID SVPGVRLMEW NYKEQDEQPV RGACVYALQH       300
     ILHNLPDLDA VALLQKISRA MAPGSRVLII EYAKNLNYTS LHASMIALFG GRERSSVEWR       360
     QMAGLCGLQV TFEVYVRAGE SLVEMRRK                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page