(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE85

PENCW_13.PE85        Location/Qualifiers
FT   CDS             join(196604..196803,196872..197021,197084..197253,
FT                   197307..197331,197383..197678,197736..197779)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946587"
FT                   /orf_name="Pc16g00850"
FT                   /product="Pc16g00850 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP92755.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001831319"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z9"
FT                   /transl_table=1
FT                   /translation="MEKPSPVYFTHEMAASASSSLGTHELKECDNNSDVEARDPLNPRN
FT                   WSSARKTMLFVSLMTSSLLADGAMVWGGTLVTDQAMEWDISIAHSATSMNYGILLQGFG
FT                   GIFAVPLIEAYGRLPIWLWPQVITMFMVLGATLSNDWSTFTTFRSLQGLFGTVPQVIGL
FT                   PIIHDMYTSAEWPRMINIWGTTFLVGPFLGPAIAGYIGAGSDWRTSFGVLTAIYGVSTV
FT                   MVILFGYETYHTPGRTTNQSRIASYFGIGNTLLPKGTTLRYWSRTVAVYVFKFPLLMTG
FT                   IAILVTFTWPIGK"
     MEKPSPVYFT HEMAASASSS LGTHELKECD NNSDVEARDP LNPRNWSSAR KTMLFVSLMT        60
     SSLLADGAMV WGGTLVTDQA MEWDISIAHS ATSMNYGILL QGFGGIFAVP LIEAYGRLPI       120
     WLWPQVITMF MVLGATLSND WSTFTTFRSL QGLFGTVPQV IGLPIIHDMY TSAEWPRMIN       180
     IWGTTFLVGP FLGPAIAGYI GAGSDWRTSF GVLTAIYGVS TVMVILFGYE TYHTPGRTTN       240
     QSRIASYFGI GNTLLPKGTT LRYWSRTVAV YVFKFPLLMT GIAILVTFTW PIGK             294
//

If you have problems or comments...

PBIL Back to PBIL home page