(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE86

PENCW_13.PE86        Location/Qualifiers
FT   CDS             join(197921..198189,198249..198504)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946588"
FT                   /orf_name="Pc16g00860"
FT                   /product="Pc16g00860 protein"
FT                   /protein_id="CAP92756.1"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000183131A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z7"
FT                   /transl_table=1
FT                   /translation="MWYVFSHPRYLRILTIFPGWAFGHFFNGWIFKRHSSTWRTELRLH
FT                   GVWFPIGSLASGLLTYGLTMHFGKHWIGIAIGWIMVNIGMVATIVAISAYALEKYPEKA
FT                   TCVSAILNMWRTCGGFAVGYFQPAWIQRNGLGLVFGIQAAIVCVAVVLTITPVFLWEQK
FT                   RRLRVGDEAEA"
     MWYVFSHPRY LRILTIFPGW AFGHFFNGWI FKRHSSTWRT ELRLHGVWFP IGSLASGLLT        60
     YGLTMHFGKH WIGIAIGWIM VNIGMVATIV AISAYALEKY PEKATCVSAI LNMWRTCGGF       120
     AVGYFQPAWI QRNGLGLVFG IQAAIVCVAV VLTITPVFLW EQKRRLRVGD EAEA             174
//

If you have problems or comments...

PBIL Back to PBIL home page