(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE87

PENCW_13.PE87        Location/Qualifiers
FT   CDS             join(complement(198994..199132),complement(198771..198907),
FT                   complement(198629..198691))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946589"
FT                   /orf_name="Pc16g00870"
FT                   /product="Putative uncharacterized protein Pc16g00870 "
FT                   /protein_id="CAP92757.1"
FT                   /db_xref="UniParc:UPI000183131B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z3"
FT                   /transl_table=1
FT                   /translation="MARNKAKKGSVIAVPEPNQFDTASALIVDNPSSRNDSVEPLNGTN
FT                   GDSCPTGSVIACGTLHSEAMIGCVECWLVGEGSGGEDQGYLIKFEIDGEQRTRTCSDRQ
FT                   PDCGLIVA"
     MARNKAKKGS VIAVPEPNQF DTASALIVDN PSSRNDSVEP LNGTNGDSCP TGSVIACGTL        60
     HSEAMIGCVE CWLVGEGSGG EDQGYLIKFE IDGEQRTRTC SDRQPDCGLI VA               112
//

If you have problems or comments...

PBIL Back to PBIL home page