(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE93

PENCW_13.PE93        Location/Qualifiers
FT   CDS             join(complement(214249..214323),complement(211736..214177))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169096" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671365"
FT                   /orf_name="Pc16g00930"
FT                   /product="Pc16g00930 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP92763.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018313EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y6"
FT                   /transl_table=1
FT                   /translation="MDEGSDKAPRRKRVSRACDRCRSKKDKCDGIRPTCSACQASGQSC
FT                   SYDPHAKKRGLPEGYVRGLEKLWALSICNIDGFEDTMLAMLGNTAESTGRREKLMSVWS
FT                   DDSASESLHESWKTSRLFGALEKMLSNSDTPGLATGKRSRNPQDDGSDGQWGFRVARTS
FT                   TPLDPGAPRVVEPFAASPGVKRARLSKESDGRGTAASPHTLQLPPQTSQLLDIYFAVTH
FT                   SWFPVVAKHNILRASYLYANTPLSIATASPGSGDHAALWAILSYTITQSRTHSRAGPAG
FT                   TVALAKEYYAVSRNLIPTEKERYEPGHIQALLLLTLVNMGLEDWTAAWLLSGQAVRMAI
FT                   AMGLGSVSDSRRSDELRQGKAVFLGCFVVDSLLSFRLSRSPAMPPSDITAVGLLEEDGL
FT                   EEWNSWVDVLPPTGAPQGSKNPPRRGPLLALSCFNRLVELASVLNKISRHVSSGYNMAT
FT                   FAQQLVMELKQWDDCLPLGCRLIGPESIYPERHSALLPHQSYLGLTYVATLLWLYLQLI
FT                   SGEQGLHRSQRPATEGAKKLLYRGLSMLTQHLENFSMCGFPPLFELSLRTMAEQAFRLR
FT                   SIVDSSDTFPFARWTDEFRQKTAAFVSVWPAYGSLVSAVERWQHSKDVVGGLSTFPGAV
FT                   GRPFSGAPMADSMQYPGGARSLPQNGEGDYTSSILGISMPVDGQSLTPKDTVMENTDLG
FT                   MMDVSPHHPREGRSVLLDKITPRSRADSMYAAASAQHQQPQPQTPDSGASNPMIPGNIT
FT                   SAGDIDAIFKDLAYLDTTEWSTNREAGLKDFGFLDDSTFQAFCHDPDRLGASQPLVHPP
FT                   SIADIWPPPGFFPETFQEVPEESMGG"
     MDEGSDKAPR RKRVSRACDR CRSKKDKCDG IRPTCSACQA SGQSCSYDPH AKKRGLPEGY        60
     VRGLEKLWAL SICNIDGFED TMLAMLGNTA ESTGRREKLM SVWSDDSASE SLHESWKTSR       120
     LFGALEKMLS NSDTPGLATG KRSRNPQDDG SDGQWGFRVA RTSTPLDPGA PRVVEPFAAS       180
     PGVKRARLSK ESDGRGTAAS PHTLQLPPQT SQLLDIYFAV THSWFPVVAK HNILRASYLY       240
     ANTPLSIATA SPGSGDHAAL WAILSYTITQ SRTHSRAGPA GTVALAKEYY AVSRNLIPTE       300
     KERYEPGHIQ ALLLLTLVNM GLEDWTAAWL LSGQAVRMAI AMGLGSVSDS RRSDELRQGK       360
     AVFLGCFVVD SLLSFRLSRS PAMPPSDITA VGLLEEDGLE EWNSWVDVLP PTGAPQGSKN       420
     PPRRGPLLAL SCFNRLVELA SVLNKISRHV SSGYNMATFA QQLVMELKQW DDCLPLGCRL       480
     IGPESIYPER HSALLPHQSY LGLTYVATLL WLYLQLISGE QGLHRSQRPA TEGAKKLLYR       540
     GLSMLTQHLE NFSMCGFPPL FELSLRTMAE QAFRLRSIVD SSDTFPFARW TDEFRQKTAA       600
     FVSVWPAYGS LVSAVERWQH SKDVVGGLST FPGAVGRPFS GAPMADSMQY PGGARSLPQN       660
     GEGDYTSSIL GISMPVDGQS LTPKDTVMEN TDLGMMDVSP HHPREGRSVL LDKITPRSRA       720
     DSMYAAASAQ HQQPQPQTPD SGASNPMIPG NITSAGDIDA IFKDLAYLDT TEWSTNREAG       780
     LKDFGFLDDS TFQAFCHDPD RLGASQPLVH PPSIADIWPP PGFFPETFQE VPEESMGG         838
//

If you have problems or comments...

PBIL Back to PBIL home page