(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE94

PENCW_13.PE94        Location/Qualifiers
FT   CDS             complement(215273..216325)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217671" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946593"
FT                   /orf_name="Pc16g00940"
FT                   /product="Pc16g00940 protein"
FT                   /protein_id="CAP92764.1"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniParc:UPI00018313ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y7"
FT                   /transl_table=1
FT                   /translation="MWNKTKTYGKKGFDKGWDALDKLGAPVNRLSNKLGSEAFWPMTLD
FT                   KESEKVARILRSFCKDGVYVEDSPPVALPPGNRKENQIDRPRGKQKVLKKIPKEVIRDA
FT                   KGLVIFTAMRTGLWVSGASGSGVLIARMPETGEWSAPSGILMHTAGVGFLVGADIYDCV
FT                   MVINTYEALEAFYNVRVTLGSEVTVAAGPIGIGGVLESEVHKRRAPIWTYVKSRGFYAG
FT                   MQVDGSIIIERNDENERFYGRKVPVKDIMSGQVRTNAPGARMLTHTVHSAQGDSHFDRV
FT                   PTGVQAPTGPTPSDFAPGDLPEYSAQPPMMSGVNAAPHGPYAAPNNAPYADTHWAPNGM
FT                   NYGPGSGKQD"
     MWNKTKTYGK KGFDKGWDAL DKLGAPVNRL SNKLGSEAFW PMTLDKESEK VARILRSFCK        60
     DGVYVEDSPP VALPPGNRKE NQIDRPRGKQ KVLKKIPKEV IRDAKGLVIF TAMRTGLWVS       120
     GASGSGVLIA RMPETGEWSA PSGILMHTAG VGFLVGADIY DCVMVINTYE ALEAFYNVRV       180
     TLGSEVTVAA GPIGIGGVLE SEVHKRRAPI WTYVKSRGFY AGMQVDGSII IERNDENERF       240
     YGRKVPVKDI MSGQVRTNAP GARMLTHTVH SAQGDSHFDR VPTGVQAPTG PTPSDFAPGD       300
     LPEYSAQPPM MSGVNAAPHG PYAAPNNAPY ADTHWAPNGM NYGPGSGKQD                  350
//

If you have problems or comments...

PBIL Back to PBIL home page