(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE95

PENCW_13.PE95        Location/Qualifiers
FT   CDS             216712..217245
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076651" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946594"
FT                   /orf_name="Pc16g00950"
FT                   /product="Pc16g00950 protein"
FT                   /protein_id="CAP92765.1"
FT                   /db_xref="UniParc:UPI00018313EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y8"
FT                   /transl_table=1
FT                   /translation="MRNKRQVFLSLHHRNSLSLGGNRQRFGYAAYHWGILISSKGPSRP
FT                   DCYAFDVSNGVVLDPVHRVNLNEEGNWHFREKVNDPDQDSLLGRVMIGKVPHEVTYAQI
FT                   RDLLESIPLPQRDALPEQNCVTWTRAAIRKLQENGLAEQFDLNRFMDESLAFADQRLHT
FT                   RSTPTSINYTTRPM"
     MRNKRQVFLS LHHRNSLSLG GNRQRFGYAA YHWGILISSK GPSRPDCYAF DVSNGVVLDP        60
     VHRVNLNEEG NWHFREKVND PDQDSLLGRV MIGKVPHEVT YAQIRDLLES IPLPQRDALP       120
     EQNCVTWTRA AIRKLQENGL AEQFDLNRFM DESLAFADQR LHTRSTPTSI NYTTRPM          177
//

If you have problems or comments...

PBIL Back to PBIL home page