(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE96

PENCW_13.PE96        Location/Qualifiers
FT   CDS             join(218357..220588,220652..220924)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169107" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946595"
FT                   /orf_name="Pc16g00960"
FT                   /product="Pc16g00960 protein"
FT                   /function="3-dehydroquinate dehydratase activity "
FT                   /function="ATP binding"
FT                   /function="shikimate 5-dehydrogenase activity"
FT                   /function="shikimate kinase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP92766.1"
FT                   /db_xref="GO:0003855"
FT                   /db_xref="GO:0004764"
FT                   /db_xref="GO:0004765"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018313EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Y9"
FT                   /transl_table=1
FT                   /translation="MLDPKPTIPPTADAKSDIPACATKESSSPMLRPEAAPRTFAPDAS
FT                   LVLIGIRGCGKRSLGFVAATALKRRFITEDHYFREVTGITRQEYLKQYGSQEFQRRDIE
FT                   VLKMMLDNHRTGCVVECGLASLTRPVQDHLRRYARSNPVVHLLRDIDRIQQLLGLEDQA
FT                   VRLFREGDPMHRICSNFEFYNLEDRTRTSDDGSPDRRSADYSFKLQEVKEDFTRFVQFI
FT                   TGLDVNYSSYDSPFVLLETPPELRSFTHAIFVRSSDLIVDNVNLTELESGGDAIELCVD
FT                   RWSPDMAATISKQVSVLRRNARTPVILSVDVSCIGTGSPEPATSSSRLYFDILEHGLRL
FT                   GVEYLVVDLTQDRSGLAATIRSRGNTKIIGQQVFEPSSPTTWDSAGCVAVYDEAEKLGC
FT                   QLVRLLRVATKREENAAVIEFSNKIRSLPGDHPPLIAYNIGSLGRTSQVFNSILTAVTH
FT                   PAITQSAENKHDPQITSRDAVRALFQSYVLDPLKFYIYGENVAYSLSPAMHNAAHQHCG
FT                   MGHTYSIPDSPSLAVLDRLGRDPHFGGSSVVQPWRVQVYQKLASKSRHAEAIGAINTIM
FT                   PLRGHEDGTMFPLQEQASRRNQAGRVLGWYGENTDWVGIMTCIRRHLSPRNAISAKTTG
FT                   LVIGAGGMARAAIYAMLRLGCRKIFIYNRTQSRAEEVARHFNSWASSQVDSTEVVRVLQ
FT                   SLQEDWPAGVAQPSLIASCVPADPDRDEPPANFEMPVQWLGSPTGGVILELAYKPLDTP
FT                   LLRQMRRVRSETGRPWVLSDGLENVTEQGIAQFELMTGRKAPRRLMTYEVLRNYVGDNG
FT                   RFDEKTIQARLDGVGSPMTGKE"
     MLDPKPTIPP TADAKSDIPA CATKESSSPM LRPEAAPRTF APDASLVLIG IRGCGKRSLG        60
     FVAATALKRR FITEDHYFRE VTGITRQEYL KQYGSQEFQR RDIEVLKMML DNHRTGCVVE       120
     CGLASLTRPV QDHLRRYARS NPVVHLLRDI DRIQQLLGLE DQAVRLFREG DPMHRICSNF       180
     EFYNLEDRTR TSDDGSPDRR SADYSFKLQE VKEDFTRFVQ FITGLDVNYS SYDSPFVLLE       240
     TPPELRSFTH AIFVRSSDLI VDNVNLTELE SGGDAIELCV DRWSPDMAAT ISKQVSVLRR       300
     NARTPVILSV DVSCIGTGSP EPATSSSRLY FDILEHGLRL GVEYLVVDLT QDRSGLAATI       360
     RSRGNTKIIG QQVFEPSSPT TWDSAGCVAV YDEAEKLGCQ LVRLLRVATK REENAAVIEF       420
     SNKIRSLPGD HPPLIAYNIG SLGRTSQVFN SILTAVTHPA ITQSAENKHD PQITSRDAVR       480
     ALFQSYVLDP LKFYIYGENV AYSLSPAMHN AAHQHCGMGH TYSIPDSPSL AVLDRLGRDP       540
     HFGGSSVVQP WRVQVYQKLA SKSRHAEAIG AINTIMPLRG HEDGTMFPLQ EQASRRNQAG       600
     RVLGWYGENT DWVGIMTCIR RHLSPRNAIS AKTTGLVIGA GGMARAAIYA MLRLGCRKIF       660
     IYNRTQSRAE EVARHFNSWA SSQVDSTEVV RVLQSLQEDW PAGVAQPSLI ASCVPADPDR       720
     DEPPANFEMP VQWLGSPTGG VILELAYKPL DTPLLRQMRR VRSETGRPWV LSDGLENVTE       780
     QGIAQFELMT GRKAPRRLMT YEVLRNYVGD NGRFDEKTIQ ARLDGVGSPM TGKE             834
//

If you have problems or comments...

PBIL Back to PBIL home page