(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE97

PENCW_13.PE97        Location/Qualifiers
FT   CDS             join(221215..221309,221366..222101)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946596"
FT                   /orf_name="Pc16g00970"
FT                   /product="Pc16g00970 protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP92767.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="UniParc:UPI00018313F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z0"
FT                   /transl_table=1
FT                   /translation="MPGFSPEQPDSITATWKKRKWDHEESRTLARPPTYVPSYRVDRPE
FT                   YDGSCSLPLSRHPDGTDISFRPRCLPRKRRHVQGPYLTLPSHQHQHQHQLQQPHGLQHQ
FT                   QSPTHLSPNIYGTPNQDPYSPPVSPKTLVPLHYPTQQSASPSALRPCHICHRRPTTRQV
FT                   LDAYADCDLCHERACFICLRQCDSASCGGAFGLSKDSSIHMHMHSGSTDDASYDASEAA
FT                   RRKICSGCAVEEVTDTGAEIVRCLDCVRGAGSWAAATIPSDWALDDMQHEDMTG"
     MPGFSPEQPD SITATWKKRK WDHEESRTLA RPPTYVPSYR VDRPEYDGSC SLPLSRHPDG        60
     TDISFRPRCL PRKRRHVQGP YLTLPSHQHQ HQHQLQQPHG LQHQQSPTHL SPNIYGTPNQ       120
     DPYSPPVSPK TLVPLHYPTQ QSASPSALRP CHICHRRPTT RQVLDAYADC DLCHERACFI       180
     CLRQCDSASC GGAFGLSKDS SIHMHMHSGS TDDASYDASE AARRKICSGC AVEEVTDTGA       240
     EIVRCLDCVR GAGSWAAATI PSDWALDDMQ HEDMTG                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page