(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE98

PENCW_13.PE98        Location/Qualifiers
FT   CDS             join(complement(223311..223815),complement(222684..223252))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169041" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824069"
FT                   /orf_name="Pc16g00980"
FT                   /product="Pc16g00980 protein"
FT                   /function="transferase activity, transferring alkyl or aryl
FT                   (other than methyl) groups"
FT                   /protein_id="CAP92768.1"
FT                   /db_xref="GO:0016765"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="UniParc:UPI00018313F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z1"
FT                   /transl_table=1
FT                   /translation="MVSQRDREILRDDLRARGTKLSAAERESLLKGYLPDPAELGTKPA
FT                   PQPTASERRKAQRKTPIRTFLKSQTHYLAYAFTHIIFGIVVRLLQAYHAVVDRIFAIVY
FT                   HHHRTPELIRKDVKNLKRLPQHLSTILTLRKEDDALAVLMDEVAELAAWSSCSGISQLS
FT                   VYEKSGVLKSCIPTLHQIITTKLASYYGTPSHQPILQVFAPHHPVHRSAPISNTTDNTA
FT                   QHQTLTILLLSSTDGRETLVDLTKTLAEMSQNGKLSPEDITPDLVDAEISEITTQPLSM
FT                   DPSLPDTVLKPEPDLLLVFGPFLKLDGYPPWQLRLTEMYCTGGRSHGLSGDGEAVEYQG
FT                   YMRGLWHFAGAQMRFGR"
     MVSQRDREIL RDDLRARGTK LSAAERESLL KGYLPDPAEL GTKPAPQPTA SERRKAQRKT        60
     PIRTFLKSQT HYLAYAFTHI IFGIVVRLLQ AYHAVVDRIF AIVYHHHRTP ELIRKDVKNL       120
     KRLPQHLSTI LTLRKEDDAL AVLMDEVAEL AAWSSCSGIS QLSVYEKSGV LKSCIPTLHQ       180
     IITTKLASYY GTPSHQPILQ VFAPHHPVHR SAPISNTTDN TAQHQTLTIL LLSSTDGRET       240
     LVDLTKTLAE MSQNGKLSPE DITPDLVDAE ISEITTQPLS MDPSLPDTVL KPEPDLLLVF       300
     GPFLKLDGYP PWQLRLTEMY CTGGRSHGLS GDGEAVEYQG YMRGLWHFAG AQMRFGR          357
//

If you have problems or comments...

PBIL Back to PBIL home page