(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_13.PE99

PENCW_13.PE99        Location/Qualifiers
FT   CDS             224209..226896
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169052" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977300"
FT                   /orf_name="Pc16g00990"
FT                   /product="Pc16g00990 protein"
FT                   /biological_process="exocytosis"
FT                   /biological_process="vesicle docking"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP92769.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0048278"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="UniParc:UPI00018313F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H6Z2"
FT                   /transl_table=1
FT                   /translation="MDNASINTSSARTVFPQGPSFTLEDFSSRDFIVKEFIESLSDAAI
FT                   SSRRSLAGLAGAANQPFDPKPLIRTFESAQRRLSELSGDLELRENELSAAVRRAEAQHG
FT                   QNLNTLGQKLRHTIENFQQLDTSLNAPGRENPAGTGNMAVETGKRLEELDRQRRRALDA
FT                   HFLIQCWDGVCNRGEISLLESLRRSGTGEAKVRSAHIARQLLRISQRLDPQSWQEHRVR
FT                   PNGGYGNSSSSEDLSESSTPRRNTREIIEKFSETLEKDLLKQFDDFYRKANFDGMRDCA
FT                   TVLQDFNGGASVIALFVNQHQFFIERSQLVTEEVGGDPESWEKLADPDAELPGVESSLQ
FT                   SLIDEVKVVVQDESAIIRRAFPYYEQVLGKFLQRVFQQSIQQRLEMVLEKAAGVSSLAF
FT                   LRCLQSSRGYIGALIEDLKSHGLTEHPEPVSSQTAILLDQQLEELFVPYFVGSSYIERE
FT                   KRTLEELFNAVLFKFTSYHARRKKAATTFMASLSRAGSELLSTTRDAFISRLDSPEVSP
FT                   IQRKVLLGVAKVGDTLETTRLTEIKLTEEDGQPNLGDAKRMLKWLAEAVGRGLELSVNS
FT                   DTPKDVSALLNLLLLAMGEGYVDVCLDAALEAATSQESSKAEPDFSYLFSARTTISITT
FT                   LMVMCIHAVLLPLSAASITTRRDMEKRTSQTTSRIEDKINTIEQKTIDATFAWVSRLLS
FT                   GQKKNDFRPRESDNTAWLEMLHTPVRSIQHSTLKKALLIPRQTCASITSFLTRLHNIAR
FT                   TSLPSSGANVRQVLTEIALGIRGLLLEHFKRFSVSGPGGLMVTKDMTQYADLFRSWDID
FT                   EETKGPGGALDVLLEVGSLFVIGPEALRERIRGGAASGTTGGSGGPGRNPTQEGKLSVQ
FT                   EVRAYVSRREDSNTFAMQQVLNAL"
     MDNASINTSS ARTVFPQGPS FTLEDFSSRD FIVKEFIESL SDAAISSRRS LAGLAGAANQ        60
     PFDPKPLIRT FESAQRRLSE LSGDLELREN ELSAAVRRAE AQHGQNLNTL GQKLRHTIEN       120
     FQQLDTSLNA PGRENPAGTG NMAVETGKRL EELDRQRRRA LDAHFLIQCW DGVCNRGEIS       180
     LLESLRRSGT GEAKVRSAHI ARQLLRISQR LDPQSWQEHR VRPNGGYGNS SSSEDLSESS       240
     TPRRNTREII EKFSETLEKD LLKQFDDFYR KANFDGMRDC ATVLQDFNGG ASVIALFVNQ       300
     HQFFIERSQL VTEEVGGDPE SWEKLADPDA ELPGVESSLQ SLIDEVKVVV QDESAIIRRA       360
     FPYYEQVLGK FLQRVFQQSI QQRLEMVLEK AAGVSSLAFL RCLQSSRGYI GALIEDLKSH       420
     GLTEHPEPVS SQTAILLDQQ LEELFVPYFV GSSYIEREKR TLEELFNAVL FKFTSYHARR       480
     KKAATTFMAS LSRAGSELLS TTRDAFISRL DSPEVSPIQR KVLLGVAKVG DTLETTRLTE       540
     IKLTEEDGQP NLGDAKRMLK WLAEAVGRGL ELSVNSDTPK DVSALLNLLL LAMGEGYVDV       600
     CLDAALEAAT SQESSKAEPD FSYLFSARTT ISITTLMVMC IHAVLLPLSA ASITTRRDME       660
     KRTSQTTSRI EDKINTIEQK TIDATFAWVS RLLSGQKKND FRPRESDNTA WLEMLHTPVR       720
     SIQHSTLKKA LLIPRQTCAS ITSFLTRLHN IARTSLPSSG ANVRQVLTEI ALGIRGLLLE       780
     HFKRFSVSGP GGLMVTKDMT QYADLFRSWD IDEETKGPGG ALDVLLEVGS LFVIGPEALR       840
     ERIRGGAASG TTGGSGGPGR NPTQEGKLSV QEVRAYVSRR EDSNTFAMQQ VLNAL            895
//

If you have problems or comments...

PBIL Back to PBIL home page