(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE1

PENCW_16.PE1         Location/Qualifiers
FT   CDS             join(complement(2138..2641),complement(1273..2107),
FT                   complement(1054..1224),complement(967..1004))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076626" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946670"
FT                   /orf_name="Pc20g00010"
FT                   /product="Pc20g00010 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85330.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001831828"
FT                   /db_xref="UniProtKB/TrEMBL:B6HER0"
FT                   /transl_table=1
FT                   /translation="MSLRPCQPCRHSRIRCSREVPHCQTCVKRGRYSLCVYETKVSDQK
FT                   PALPEPRSKQQKQKQERASDEYHFRWRAFEPQSEQFPRYETSTNEKMQHAMEPANEEHI
FT                   KHMSQRYSEQGSLSPHETPPKSIAAAKAEKASIFQPKHVEDTSERPRSTPVPQPTELYA
FT                   QMIPPTTTLTVNKASLPPRPNFDLTISGRHICGPHTAHQLLLVLNYLFISSMLPADIGA
FT                   LWKVICRRHHDWEESFVLQHEQLQRWLISVRNILTNSDGLHTVTLEDIERQTRYILFIL
FT                   GENTSPHSSFIFECFRSEEPPYRPFGVRASIALICHAFGGIQADELEGYEAKEIWTRDQ
FT                   NFLSTMAFRLKESPLFGAEVSVNHLQSMILGLQKAFQCEEIRVSGMEFQTLRIESELEV
FT                   LGYYRRAFLAFNPILLPKILASLREANDLTTLLWHYQLINMERNLDRTNLALRLANIFM
FT                   SLAPERLDAAFQNTREIQLSKAXRVVAMEMMHVKSFEEAYKLNPTKPTTVRVFHVSP"
     MSLRPCQPCR HSRIRCSREV PHCQTCVKRG RYSLCVYETK VSDQKPALPE PRSKQQKQKQ        60
     ERASDEYHFR WRAFEPQSEQ FPRYETSTNE KMQHAMEPAN EEHIKHMSQR YSEQGSLSPH       120
     ETPPKSIAAA KAEKASIFQP KHVEDTSERP RSTPVPQPTE LYAQMIPPTT TLTVNKASLP       180
     PRPNFDLTIS GRHICGPHTA HQLLLVLNYL FISSMLPADI GALWKVICRR HHDWEESFVL       240
     QHEQLQRWLI SVRNILTNSD GLHTVTLEDI ERQTRYILFI LGENTSPHSS FIFECFRSEE       300
     PPYRPFGVRA SIALICHAFG GIQADELEGY EAKEIWTRDQ NFLSTMAFRL KESPLFGAEV       360
     SVNHLQSMIL GLQKAFQCEE IRVSGMEFQT LRIESELEVL GYYRRAFLAF NPILLPKILA       420
     SLREANDLTT LLWHYQLINM ERNLDRTNLA LRLANIFMSL APERLDAAFQ NTREIQLSKA       480
     XRVVAMEMMH VKSFEEAYKL NPTKPTTVRV FHVSP                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page