(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE100

PENCW_16.PE100       Location/Qualifiers
FT   CDS             join(224159..224229,224374..224644)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977345"
FT                   /orf_name="Pc20g01000"
FT                   /product="Pc20g01000 protein"
FT                   /function="poly(ADP-ribose) glycohydrolase activity "
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85429.1"
FT                   /db_xref="GO:0004649"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR007724"
FT                   /db_xref="UniParc:UPI0001831D55"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR4"
FT                   /transl_table=1
FT                   /translation="MADGPPWTKYCMTDQGQRLTGATGNTRKPYSFVTTGLWGCGAFGG
FT                   NRQVKAIIQWYAASLANVLELRYVLGGEEQKVFRDVFDVLVRLGTDLQNGKAAVPKPDE
FT                   IFEYVLQSL"
     MADGPPWTKY CMTDQGQRLT GATGNTRKPY SFVTTGLWGC GAFGGNRQVK AIIQWYAASL        60
     ANVLELRYVL GGEEQKVFRD VFDVLVRLGT DLQNGKAAVP KPDEIFEYVL QSL              113
//

If you have problems or comments...

PBIL Back to PBIL home page