(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE101

PENCW_16.PE101       Location/Qualifiers
FT   CDS             join(complement(227954..229540),complement(227526..227884),
FT                   complement(227166..227346),complement(225175..227052))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128440"
FT                   /orf_name="Pc20g01010"
FT                   /product="Pc20g01010 protein"
FT                   /function="ATP binding"
FT                   /function="glycine-tRNA ligase activity"
FT                   /biological_process="glycyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85430.1"
FT                   /db_xref="GO:0004820"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006426"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniParc:UPI0001831D56"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR5"
FT                   /transl_table=1
FT                   /translation="MATVNTKTGQAVDRTVLDSMLRRRMFYTPSFEIYGGVSGLYDYGP
FT                   PGTALIANMTDLWRKHFVLEEDMLEVDTTMLTPHEILKTSGHVDKFADWMCKDPKTGEI
FT                   FRADHLVEEVLEARLKGDKQARGEKIEVDEEKEAKKKRKAKSTEAKKLDDALVKEYEET
FT                   LAQIDNYGGPELEQLIKKHDIRNPVTGGEVLPPVSFNLMFQTSIGPSSNMPGYLRPETA
FT                   QGQFLNFAKLLEFNQQSMPFASASIGKSFRNEISPRAGLLRVREFLMAEIEHYVDPEGG
FT                   KKHSRFDEVKDTELSLLDRNVQLSGSTNLTKMTVGKAVETGLVDNETLGYFLARIQSFL
FT                   LKLGVDPAKLRFRQHMANEMAHYATDCWDAELQTSYGWIECVGCADRSAYDLTVHKDKT
FT                   GAPLVVRQTRAEPLRIEEYQIDLEKKKFGPRFKKDAKTVEAAIEALSQDLREKLSLDLE
FT                   KDGKIEVDVEGVGSGKVEIEKDLIKIEKRTRVENVREYTPNVIEPSFGIGRILYSVIEH
FT                   SYWYRAGDETRGVLSFPPAIAPTKVLLVPLSTHASFKPLTQRLTSKLRKAGVSNRVDDS
FT                   SASIGKRYSRNDELGTPFGVTVDFQSVQDNTFTLRDRDTTKQVRASEDEILQAVKSLVE
FT                   GDETWEDIRKRLPEIRGTSVIDLSSFHSPLSTTMAPTVHSAKLTLSCPLFAADFDPRNN
FT                   GRLLVGGGGGEGRSGITEAVELNLSRDEDSVTSLAAAPLAGDEAGSLVALAGINSSVEQ
FT                   QKKNNNQHLRAFRFEAPRKTTEDRKQDEKAKKDAKSEEEVIPGRAIALSQASLFRTKNG
FT                   PGSSDTYQRVTRLSPWPKGKDGTEKHTRIGAVATGLAQSGEIVFFRATETPSEKDIIGR
FT                   IQLSSNEEAEDMDFVSLEHDLEKTDDGHGRFLVAYTNGTDVMVGEISCSSSSNSSPDVR
FT                   SVYNIPLPASGARTARPKFRALRFLSPRTLLLLQNAPNRGGSELVLLQLPSAKSSKSKV
FT                   LQRRKLPRTVKIGLGLDICQLGTNPQGQQQTVIAASGSDNSIPLFTLEYGPNRGYSNFR
FT                   PYTTLRDVHPFSMTKLTFSTFIAPPHPVTPDVGPQNIKLASVSMGNTVVVHTFPLSPFP
FT                   TSSRTPRYVLVTPGPAEIWELIYSIIVLLFSISAICVAMLAFAEIRGGTPPVLGATEWL
FT                   PESIRGAIAREYVIPPRDKLTYFDTLLAPRGSGGDTDTPVATIVPTESQIESLREILDR
FT                   VHRAGAAPADLETVAPQSLSVIVRCGAGQNAEQSVIVETAVSASGEAEQSEEEKLQAWK
FT                   DLSASEQSVWKQRLADAGRWTASEGESVLLGVLFGEACGGLGRAVRDELP"
     MATVNTKTGQ AVDRTVLDSM LRRRMFYTPS FEIYGGVSGL YDYGPPGTAL IANMTDLWRK        60
     HFVLEEDMLE VDTTMLTPHE ILKTSGHVDK FADWMCKDPK TGEIFRADHL VEEVLEARLK       120
     GDKQARGEKI EVDEEKEAKK KRKAKSTEAK KLDDALVKEY EETLAQIDNY GGPELEQLIK       180
     KHDIRNPVTG GEVLPPVSFN LMFQTSIGPS SNMPGYLRPE TAQGQFLNFA KLLEFNQQSM       240
     PFASASIGKS FRNEISPRAG LLRVREFLMA EIEHYVDPEG GKKHSRFDEV KDTELSLLDR       300
     NVQLSGSTNL TKMTVGKAVE TGLVDNETLG YFLARIQSFL LKLGVDPAKL RFRQHMANEM       360
     AHYATDCWDA ELQTSYGWIE CVGCADRSAY DLTVHKDKTG APLVVRQTRA EPLRIEEYQI       420
     DLEKKKFGPR FKKDAKTVEA AIEALSQDLR EKLSLDLEKD GKIEVDVEGV GSGKVEIEKD       480
     LIKIEKRTRV ENVREYTPNV IEPSFGIGRI LYSVIEHSYW YRAGDETRGV LSFPPAIAPT       540
     KVLLVPLSTH ASFKPLTQRL TSKLRKAGVS NRVDDSSASI GKRYSRNDEL GTPFGVTVDF       600
     QSVQDNTFTL RDRDTTKQVR ASEDEILQAV KSLVEGDETW EDIRKRLPEI RGTSVIDLSS       660
     FHSPLSTTMA PTVHSAKLTL SCPLFAADFD PRNNGRLLVG GGGGEGRSGI TEAVELNLSR       720
     DEDSVTSLAA APLAGDEAGS LVALAGINSS VEQQKKNNNQ HLRAFRFEAP RKTTEDRKQD       780
     EKAKKDAKSE EEVIPGRAIA LSQASLFRTK NGPGSSDTYQ RVTRLSPWPK GKDGTEKHTR       840
     IGAVATGLAQ SGEIVFFRAT ETPSEKDIIG RIQLSSNEEA EDMDFVSLEH DLEKTDDGHG       900
     RFLVAYTNGT DVMVGEISCS SSSNSSPDVR SVYNIPLPAS GARTARPKFR ALRFLSPRTL       960
     LLLQNAPNRG GSELVLLQLP SAKSSKSKVL QRRKLPRTVK IGLGLDICQL GTNPQGQQQT      1020
     VIAASGSDNS IPLFTLEYGP NRGYSNFRPY TTLRDVHPFS MTKLTFSTFI APPHPVTPDV      1080
     GPQNIKLASV SMGNTVVVHT FPLSPFPTSS RTPRYVLVTP GPAEIWELIY SIIVLLFSIS      1140
     AICVAMLAFA EIRGGTPPVL GATEWLPESI RGAIAREYVI PPRDKLTYFD TLLAPRGSGG      1200
     DTDTPVATIV PTESQIESLR EILDRVHRAG AAPADLETVA PQSLSVIVRC GAGQNAEQSV      1260
     IVETAVSASG EAEQSEEEKL QAWKDLSASE QSVWKQRLAD AGRWTASEGE SVLLGVLFGE      1320
     ACGGLGRAVR DELP                                                        1334
//

If you have problems or comments...

PBIL Back to PBIL home page