(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE102

PENCW_16.PE102       Location/Qualifiers
FT   CDS             229921..231216
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172062" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946715"
FT                   /orf_name="Pc20g01020"
FT                   /product="Pc20g01020 protein"
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /biological_process="translation"
FT                   /protein_id="CAP85431.1"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI0001831D57"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR6"
FT                   /transl_table=1
FT                   /translation="MGVPGRSGPPPGVMGDIKTGNKLRRKMNHVKRKRAKDAARREERY
FT                   AFKKEEAKNPKLKEERLRRNIPLTLERKRVWNEADNDTEETGLGLSVDVERIKRAKKEE
FT                   EDELNRPLEEGEDDSEVPESDNESVDSMLESDNSEDEDEGEEKNEDQDASRGRKKTSLR
FT                   TATERATSPTQSTRSTNLSLAPEALAAKFPTLFTEGPPPTPKILITTGLNSTLHVQAET
FT                   LTDVFPNSVYIRRNAHRYSHKFSIREISKFASNRNFTAVVVLNEDQKRPSGLTIVHLPV
FT                   GPTFHFSISNWIDGKRLPGHGRATDHWPELILNNFRTPLGLLTAHLFRTLFPPQPEFEG
FT                   RQVVTLHNQRDYIFVRRHRYVFREKRETEKAVVGADGKEMAGAEGIRTGLQELGPRFTL
FT                   KLRRVDKGIQRASGQEWEWKGGMEKTRTLFQL"
     MGVPGRSGPP PGVMGDIKTG NKLRRKMNHV KRKRAKDAAR REERYAFKKE EAKNPKLKEE        60
     RLRRNIPLTL ERKRVWNEAD NDTEETGLGL SVDVERIKRA KKEEEDELNR PLEEGEDDSE       120
     VPESDNESVD SMLESDNSED EDEGEEKNED QDASRGRKKT SLRTATERAT SPTQSTRSTN       180
     LSLAPEALAA KFPTLFTEGP PPTPKILITT GLNSTLHVQA ETLTDVFPNS VYIRRNAHRY       240
     SHKFSIREIS KFASNRNFTA VVVLNEDQKR PSGLTIVHLP VGPTFHFSIS NWIDGKRLPG       300
     HGRATDHWPE LILNNFRTPL GLLTAHLFRT LFPPQPEFEG RQVVTLHNQR DYIFVRRHRY       360
     VFREKRETEK AVVGADGKEM AGAEGIRTGL QELGPRFTLK LRRVDKGIQR ASGQEWEWKG       420
     GMEKTRTLFQ L                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page