(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE105

PENCW_16.PE105       Location/Qualifiers
FT   CDS             join(complement(234385..234397),complement(234256..234306),
FT                   complement(234069..234114),complement(233922..233995),
FT                   complement(233711..233858),complement(233199..233652))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172086" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946718"
FT                   /orf_name="Pc20g01050"
FT                   /product="Pc20g01050 protein"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85434.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="InterPro:IPR003005"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="InterPro:IPR010504"
FT                   /db_xref="UniParc:UPI0001831D5A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGR9"
FT                   /transl_table=1
FT                   /translation="MSWAGFKKNVNRATTQVMMKTGHVERTNDRDYEIEERRYRTMETA
FT                   ATRLQKESKGYLDSLRAMTASQMRIAETIDAFYGDAGTKDGVSRSYKQAVEDLDAETIK
FT                   ALDGPYRTTVLDPISRFCAYFPDVNECIKKRNHKLLDYDAMRAKVKKLAEKPDKDVTKL
FT                   PRTEREAEMAKQAYEQLNEQLFNELPQLIDLRVPYLDPSFEALVKIQLRFCAEAYSRMA
FT                   QVQQYLDAETRDQYAKGDLDNRVEEVLQEIRDLSIAGTV"
     MSWAGFKKNV NRATTQVMMK TGHVERTNDR DYEIEERRYR TMETAATRLQ KESKGYLDSL        60
     RAMTASQMRI AETIDAFYGD AGTKDGVSRS YKQAVEDLDA ETIKALDGPY RTTVLDPISR       120
     FCAYFPDVNE CIKKRNHKLL DYDAMRAKVK KLAEKPDKDV TKLPRTEREA EMAKQAYEQL       180
     NEQLFNELPQ LIDLRVPYLD PSFEALVKIQ LRFCAEAYSR MAQVQQYLDA ETRDQYAKGD       240
     LDNRVEEVLQ EIRDLSIAGT V                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page