(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE106

PENCW_16.PE106       Location/Qualifiers
FT   CDS             join(complement(236757..238220),complement(236568..236699))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172097" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946719"
FT                   /orf_name="Pc20g01060"
FT                   /product="Pc20g01060 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85435.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015729"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0001831D5B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS0"
FT                   /transl_table=1
FT                   /translation="MTPPSPSPVPSAVSSAAASQHSHDPRDGDASVTRAIAGMNLAAHA
FT                   NGEALPPPASPAAKPTRSTMAARLTRMFSSTGKNTPPRENNEVPRDLSDSSLESIQPLN
FT                   GRTSKPSSRPASRPPSRPPSRGENSRTPSRNPSLKSEPLEKYDKKKMDDKKKDGASVHK
FT                   RFEVLTEALGNHSHNLRSARRQEKLTDLLRDMMGGRKKDDQVDEQQLSLMSTWIDQFKT
FT                   ERDKLAADKKGGPNATASLVDKYGKCQEIVGRGAFGIVRISHKVDPQDSKCEQLYAVKE
FT                   FRRRPQETTKKYQKRLTSEFCISSSLRHPNVIHTLDLLQDAKGDYCEVMEYCAGGDLYT
FT                   LVLAAGKLEVAEADCFFKQLMRGVEYMHEMGVAHRDLKPENLLLTTHGALKITDFGNGE
FT                   CFRMAWEKEAHMTAGLCGSAPYIAPEEYVEREFDPRAVDLWATGVIYMAMRTGRHLWRV
FT                   ARKDEDEFYQRYLDGRKHEDGYAPIETLHRARCRNVIYSILDPNPSRRINASQVLKSEW
FT                   VRQIKLCKAGEEGF"
     MTPPSPSPVP SAVSSAAASQ HSHDPRDGDA SVTRAIAGMN LAAHANGEAL PPPASPAAKP        60
     TRSTMAARLT RMFSSTGKNT PPRENNEVPR DLSDSSLESI QPLNGRTSKP SSRPASRPPS       120
     RPPSRGENSR TPSRNPSLKS EPLEKYDKKK MDDKKKDGAS VHKRFEVLTE ALGNHSHNLR       180
     SARRQEKLTD LLRDMMGGRK KDDQVDEQQL SLMSTWIDQF KTERDKLAAD KKGGPNATAS       240
     LVDKYGKCQE IVGRGAFGIV RISHKVDPQD SKCEQLYAVK EFRRRPQETT KKYQKRLTSE       300
     FCISSSLRHP NVIHTLDLLQ DAKGDYCEVM EYCAGGDLYT LVLAAGKLEV AEADCFFKQL       360
     MRGVEYMHEM GVAHRDLKPE NLLLTTHGAL KITDFGNGEC FRMAWEKEAH MTAGLCGSAP       420
     YIAPEEYVER EFDPRAVDLW ATGVIYMAMR TGRHLWRVAR KDEDEFYQRY LDGRKHEDGY       480
     APIETLHRAR CRNVIYSILD PNPSRRINAS QVLKSEWVRQ IKLCKAGEEG F                531
//

If you have problems or comments...

PBIL Back to PBIL home page