(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE107

PENCW_16.PE107       Location/Qualifiers
FT   CDS             join(complement(243833..243869),complement(243572..243770),
FT                   complement(243345..243490),complement(243175..243278))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824096"
FT                   /orf_name="Pc20g01070"
FT                   /product="Pc20g01070 protein"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /cellular_component="cis-Golgi network"
FT                   /protein_id="CAP85436.1"
FT                   /db_xref="GO:0005801"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="InterPro:IPR007233"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI0001831E3E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS1"
FT                   /transl_table=1
FT                   /translation="MVVYSFYIFDRHAECIYKRRWLPRPTSTVGKSRSDTVSGAAPTGL
FT                   GQTVRSTDDDSKLVFGTVFSLRNMVRKLGGEDDNFVSFTTSQYKLHYYETPTNTKFVML
FT                   TDLKSPSMRIALQQIYINLFVEYVVKNPLSPTEHPGGVGVNNELFEESLEQFVVRAL"
     MVVYSFYIFD RHAECIYKRR WLPRPTSTVG KSRSDTVSGA APTGLGQTVR STDDDSKLVF        60
     GTVFSLRNMV RKLGGEDDNF VSFTTSQYKL HYYETPTNTK FVMLTDLKSP SMRIALQQIY       120
     INLFVEYVVK NPLSPTEHPG GVGVNNELFE ESLEQFVVRA L                           161
//

If you have problems or comments...

PBIL Back to PBIL home page