(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE108

PENCW_16.PE108       Location/Qualifiers
FT   CDS             join(244217..244296,244364..244448,244505..244654,
FT                   244733..245527,245578..245715,245767..246966)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172119" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671395"
FT                   /orf_name="Pc20g01080"
FT                   /product="Pc20g01080 protein"
FT                   /EC_number="2.7.11.17"
FT                   /function="ATP binding"
FT                   /function="calmodulin-dependent protein kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85437.1"
FT                   /db_xref="GO:0004683"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020657"
FT                   /db_xref="UniParc:UPI0001831E3F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS2"
FT                   /transl_table=1
FT                   /translation="MSDISAEPSTSSLEGMSDARPQASRFPQSPPRSTASHDSYARHRR
FT                   RNPRSRRPVKETLNARSSYYTSQDDGTAEHRINQYIIKQEIGRGSFGAVHLAADQYGNE
FT                   YAVKEFSKSRLRKRAQSHMLRRPRGPIRGGTDFNSPLHRHPSGDDTETAKNPLYLIKEE
FT                   IAIMKKLNHNNLVSLIEVLDDPTEDSLYMVMEMCKKGVVMKVGLEEKADPYDDEQCRCW
FT                   FRDLILGIEYLHSQGIVHRDIKPDNCLVTNDDILKVVDFGVSEMFEKDSNMFTGKSAGS
FT                   PAFLPPELCVAKHGDVSGRATDIWSMGVTLYCLRYGRLPFEKQSIFELYDSIRGDTLVY
FT                   EDESDEVFKDLIGRILEKDPEKRIDMFALREHPWVTKNGTDPLLSFEENTSQIIEPPTE
FT                   EEMNSAITRKMGHLVTVMKAVQRFKRLTDPMKPQSPIQSTFGSILGGDHDAFLVEPPME
FT                   MDPDEPFPTVGAALQTHDSNGPDVRKNFPRRPFAGFRENAGCIGSTDSASFSSQPEHSP
FT                   SNSKIPSGVTEPERRDSGSIRSWGSTAQPDVGHEAQPHSQSASPHIPLSRASSSRTKRS
FT                   MEGTRGHARDPLEEEFPYLFIGPSTYNGSSQQDTVPGDEPASILQEPGHSMDPSDQMED
FT                   EEPVQFVSESPGAADFNIYETAYRKELDRIKNNLKDRDTGRKVYLTRFVEENSAEVLKL
FT                   SKEKELDLQMGDDFTPSPLSRTPSGFGTAVSALRSQILQKRQAEEPEEQGGDARKDKDY
FT                   SQNREPHPHPPKRLSVPSQSIPEPESSSLEATGVSSTEGNGDSKAQLRRILDRVRGKSD
FT                   GAE"
     MSDISAEPST SSLEGMSDAR PQASRFPQSP PRSTASHDSY ARHRRRNPRS RRPVKETLNA        60
     RSSYYTSQDD GTAEHRINQY IIKQEIGRGS FGAVHLAADQ YGNEYAVKEF SKSRLRKRAQ       120
     SHMLRRPRGP IRGGTDFNSP LHRHPSGDDT ETAKNPLYLI KEEIAIMKKL NHNNLVSLIE       180
     VLDDPTEDSL YMVMEMCKKG VVMKVGLEEK ADPYDDEQCR CWFRDLILGI EYLHSQGIVH       240
     RDIKPDNCLV TNDDILKVVD FGVSEMFEKD SNMFTGKSAG SPAFLPPELC VAKHGDVSGR       300
     ATDIWSMGVT LYCLRYGRLP FEKQSIFELY DSIRGDTLVY EDESDEVFKD LIGRILEKDP       360
     EKRIDMFALR EHPWVTKNGT DPLLSFEENT SQIIEPPTEE EMNSAITRKM GHLVTVMKAV       420
     QRFKRLTDPM KPQSPIQSTF GSILGGDHDA FLVEPPMEMD PDEPFPTVGA ALQTHDSNGP       480
     DVRKNFPRRP FAGFRENAGC IGSTDSASFS SQPEHSPSNS KIPSGVTEPE RRDSGSIRSW       540
     GSTAQPDVGH EAQPHSQSAS PHIPLSRASS SRTKRSMEGT RGHARDPLEE EFPYLFIGPS       600
     TYNGSSQQDT VPGDEPASIL QEPGHSMDPS DQMEDEEPVQ FVSESPGAAD FNIYETAYRK       660
     ELDRIKNNLK DRDTGRKVYL TRFVEENSAE VLKLSKEKEL DLQMGDDFTP SPLSRTPSGF       720
     GTAVSALRSQ ILQKRQAEEP EEQGGDARKD KDYSQNREPH PHPPKRLSVP SQSIPEPESS       780
     SLEATGVSST EGNGDSKAQL RRILDRVRGK SDGAE                                  815
//

If you have problems or comments...

PBIL Back to PBIL home page