(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE109

PENCW_16.PE109       Location/Qualifiers
FT   CDS             join(complement(249825..249866),complement(249658..249772),
FT                   complement(248711..249558))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216941" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946720"
FT                   /orf_name="Pc20g01090"
FT                   /product="Pc20g01090 protein"
FT                   /function="DNA binding"
FT                   /protein_id="CAP85438.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI0001831E40"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS3"
FT                   /transl_table=1
FT                   /translation="MSNPSDRPWTEEDKYTLLTEILKKAGFPSSYLVRMIKEYGITPSW
FT                   EHIPLPQGRSLSSCKTAYLNMVQQPVHPPHPVAPFPPRSDITGPPASMDPSTMRKRPLY
FT                   PSDKPIPRAIQPRPPASTASYSSESGASAQLSPRLDTGPGEPPRKRGRPSKAETERRKL
FT                   LAEARGETYPAPRRSGSGRLKVPPSPTSPAAGPSSTPFPPAPQAFHGPKPGPVPMLYDT
FT                   SAMRSAIPPGPGPASNDERRDMPARGMGTNMRELPRPTEMGHPLPSPHALQLGPPDAFP
FT                   RLSNPVERPYSFSADRFSPPDSGRRDSVTSRSDQPGPYSEGRMSTTPAEQAPR"
     MSNPSDRPWT EEDKYTLLTE ILKKAGFPSS YLVRMIKEYG ITPSWEHIPL PQGRSLSSCK        60
     TAYLNMVQQP VHPPHPVAPF PPRSDITGPP ASMDPSTMRK RPLYPSDKPI PRAIQPRPPA       120
     STASYSSESG ASAQLSPRLD TGPGEPPRKR GRPSKAETER RKLLAEARGE TYPAPRRSGS       180
     GRLKVPPSPT SPAAGPSSTP FPPAPQAFHG PKPGPVPMLY DTSAMRSAIP PGPGPASNDE       240
     RRDMPARGMG TNMRELPRPT EMGHPLPSPH ALQLGPPDAF PRLSNPVERP YSFSADRFSP       300
     PDSGRRDSVT SRSDQPGPYS EGRMSTTPAE QAPR                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page