(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE110

PENCW_16.PE110       Location/Qualifiers
FT   CDS             join(252120..252516,252636..254252,254305..254357)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172130" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946721"
FT                   /orf_name="Pc20g01100"
FT                   /product="Pc20g01100 protein"
FT                   /function="DNA binding"
FT                   /function="histone-lysine N-methyltransferase activity "
FT                   /function="transcription regulator activity"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85439.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0018024"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR006560"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="UniParc:UPI0001831E41"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS4"
FT                   /transl_table=1
FT                   /translation="MSAHDYADSEEPAKMERDSPVNGNHLKNGDSRTSSRSPLPPKKES
FT                   SPNSDAPDPMKENIGEIVLKQEPGQPPKLSRSSSQKVASRPPPLYTHLPDSTQDALATF
FT                   EQIPGCIYANKYMGYTEHAMECDCAEEWDPKIGRNIACGEDSDCINRATKIECAGECGC
FT                   GPDCQNQRFQKRQFAPVSVIKTEKKGFGLRAEKNLDPGELIYEYVGEVVGEQQFRKRMR
FT                   QYDEEGIKHFYFMSLNKGEFVDATKRGNLGRFCNHSCNPNCYVDKWVVGEKLRMGIFAE
FT                   RAVQAGEELVFNYNVDRYGADPQPCYCGEPMCTGFIGGRTQTERATKLSNATIEALGID
FT                   EADGWDTVVAKRPKKKKMEEDDEEYVDSVQPKSLDEDGVTKVMAALVQCQEKWIAVKLL
FT                   GRIQRCDDERVRNRVVRMHGYQILNSQLAQWKEDQNVVLQILNILDGFPRLTRNKIQDS
FT                   KIETNIRPLTTCDDERVPKKAVALLESWAGLEVAYRIPRMKRGKDAKQAINQFERRETG
FT                   QEQRQRSLTRSPSPVYDAPRGPAQQRRDRGPQRSRQPNRRGPRPLPEGWYTAEAEGRVY
FT                   YYSASGKTTWERPTLPATPATPAPGQPAKNQQNLALQSIIDGIMNTQEDTPSENRTATP
FT                   VTPQPSADQPERRHKDGEKWRKLPLEKQKRIYENTVTFPAYQARGGSVQTQDP"
     MSAHDYADSE EPAKMERDSP VNGNHLKNGD SRTSSRSPLP PKKESSPNSD APDPMKENIG        60
     EIVLKQEPGQ PPKLSRSSSQ KVASRPPPLY THLPDSTQDA LATFEQIPGC IYANKYMGYT       120
     EHAMECDCAE EWDPKIGRNI ACGEDSDCIN RATKIECAGE CGCGPDCQNQ RFQKRQFAPV       180
     SVIKTEKKGF GLRAEKNLDP GELIYEYVGE VVGEQQFRKR MRQYDEEGIK HFYFMSLNKG       240
     EFVDATKRGN LGRFCNHSCN PNCYVDKWVV GEKLRMGIFA ERAVQAGEEL VFNYNVDRYG       300
     ADPQPCYCGE PMCTGFIGGR TQTERATKLS NATIEALGID EADGWDTVVA KRPKKKKMEE       360
     DDEEYVDSVQ PKSLDEDGVT KVMAALVQCQ EKWIAVKLLG RIQRCDDERV RNRVVRMHGY       420
     QILNSQLAQW KEDQNVVLQI LNILDGFPRL TRNKIQDSKI ETNIRPLTTC DDERVPKKAV       480
     ALLESWAGLE VAYRIPRMKR GKDAKQAINQ FERRETGQEQ RQRSLTRSPS PVYDAPRGPA       540
     QQRRDRGPQR SRQPNRRGPR PLPEGWYTAE AEGRVYYYSA SGKTTWERPT LPATPATPAP       600
     GQPAKNQQNL ALQSIIDGIM NTQEDTPSEN RTATPVTPQP SADQPERRHK DGEKWRKLPL       660
     EKQKRIYENT VTFPAYQARG GSVQTQDP                                          688
//

If you have problems or comments...

PBIL Back to PBIL home page