(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE111

PENCW_16.PE111       Location/Qualifiers
FT   CDS             join(254424..254430,254587..255023)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128441"
FT                   /orf_name="Pc20g01110"
FT                   /product="Putative uncharacterized protein Pc20g01110 "
FT                   /protein_id="CAP85440.1"
FT                   /db_xref="UniParc:UPI0001831E42"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS5"
FT                   /transl_table=1
FT                   /translation="MKSKYVDRGKHEAEKSQDATPNPGSEVHSTGDDEAVAGASASSPL
FT                   EDDDAASLKRKRNGTLNVDGAEDGASSPSKRQKSTPPPPPPPPPPADLPQDDADGDTSM
FT                   GNTGNDSSHPKDDSGAGVDVNMEIEAENNPQTERPQISVEGQV"
     MKSKYVDRGK HEAEKSQDAT PNPGSEVHST GDDEAVAGAS ASSPLEDDDA ASLKRKRNGT        60
     LNVDGAEDGA SSPSKRQKST PPPPPPPPPP ADLPQDDADG DTSMGNTGND SSHPKDDSGA       120
     GVDVNMEIEA ENNPQTERPQ ISVEGQV                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page