(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE112

PENCW_16.PE112       Location/Qualifiers
FT   CDS             join(complement(256807..256841),complement(256675..256746),
FT                   complement(256416..256502),complement(256134..256322),
FT                   complement(255666..256026))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230605" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977581"
FT                   /orf_name="Pc20g01120"
FT                   /product="Pc20g01120 protein"
FT                   /function="ribosome binding"
FT                   /biological_process="mature ribosome assembly"
FT                   /protein_id="CAP85441.1"
FT                   /db_xref="GO:0042256"
FT                   /db_xref="GO:0043022"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniParc:UPI0001831E43"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH38"
FT                   /transl_table=1
FT                   /translation="MAVRAQFENSNEVGVFSCLTNAYAIVAVGASENFYSVFESELQDV
FT                   IPICHATIAGTRIVGRLIVGNRKGLLVPTTTTDQELQHLRNTLPAEVKIQRIEERLSAL
FT                   GNVICCNDHVAIVHPDLERETEEIIADVLGVEVFRQTVADNVLTGSYMALSNQGGIVHP
FT                   KTSIRDQDELSSLLQVPLVAGSVNRGSPVVGAGMVVNDWLAITGLDTTATELSVVESVF
FT                   RLGEMAPGGAGGAAVNKDSIVESFY"
     MAVRAQFENS NEVGVFSCLT NAYAIVAVGA SENFYSVFES ELQDVIPICH ATIAGTRIVG        60
     RLIVGNRKGL LVPTTTTDQE LQHLRNTLPA EVKIQRIEER LSALGNVICC NDHVAIVHPD       120
     LERETEEIIA DVLGVEVFRQ TVADNVLTGS YMALSNQGGI VHPKTSIRDQ DELSSLLQVP       180
     LVAGSVNRGS PVVGAGMVVN DWLAITGLDT TATELSVVES VFRLGEMAPG GAGGAAVNKD       240
     SIVESFY                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page