(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE114

PENCW_16.PE114       Location/Qualifiers
FT   CDS             complement(263597..264763)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671671"
FT                   /orf_name="Pc20g01140"
FT                   /product="Pc20g01140 protein"
FT                   /protein_id="CAP85443.1"
FT                   /db_xref="UniParc:UPI0001831E44"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH39"
FT                   /transl_table=1
FT                   /translation="MPHLSYSLAAASLLATFIVTILSGICYATSKASPDVASTILSAVS
FT                   CMALIALGLLHHQNIQTGRRLWICFAGGYLLIAAAASAGAMARSPQASVFVVRSVFWAL
FT                   SVFAQGLYCGFLAMTLAQEKSNPQWPRAYSQEVHSQELKDIPQSPNFLPSPPRVCDLSE
FT                   LFEPKRSSLRKFPRRSSRYSDTTLCPTSTKEEKNASIDNSSSTHTSPSPSPTRDRMPDT
FT                   LPDRDTRPLLRGTHSIRSMPSLRRNPPTALPLDSRVHPSMPSPTASTIRIDSPTQSSSN
FT                   NSTWEYNPFSENNIHPLFRSTSPCPSPTFSPGTMVKASPSAGQTITAGTITRMRSARSL
FT                   HDHAMRAPSPLPGSESEETIRTRPNPTLGFAHSQSVKRYDLNESPYEK"
     MPHLSYSLAA ASLLATFIVT ILSGICYATS KASPDVASTI LSAVSCMALI ALGLLHHQNI        60
     QTGRRLWICF AGGYLLIAAA ASAGAMARSP QASVFVVRSV FWALSVFAQG LYCGFLAMTL       120
     AQEKSNPQWP RAYSQEVHSQ ELKDIPQSPN FLPSPPRVCD LSELFEPKRS SLRKFPRRSS       180
     RYSDTTLCPT STKEEKNASI DNSSSTHTSP SPSPTRDRMP DTLPDRDTRP LLRGTHSIRS       240
     MPSLRRNPPT ALPLDSRVHP SMPSPTASTI RIDSPTQSSS NNSTWEYNPF SENNIHPLFR       300
     STSPCPSPTF SPGTMVKASP SAGQTITAGT ITRMRSARSL HDHAMRAPSP LPGSESEETI       360
     RTRPNPTLGF AHSQSVKRYD LNESPYEK                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page