(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE115

PENCW_16.PE115       Location/Qualifiers
FT   CDS             join(266302..266319,266382..266429,266493..266568,
FT                   266647..266726,266794..267126,267179..267649,2
FT                   67704..267820)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172162" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947735"
FT                   /orf_name="Pc20g01150"
FT                   /product="Pc20g01150 protein"
FT                   /function="damaged DNA binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /biological_process="proteasomal ubiquitin-dependent
FT                   protein catabolic process"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85444.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="GO:0043161"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR004806"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015360"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI0001831E45"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH40"
FT                   /transl_table=1
FT                   /translation="MKLTFKDLKQEKFVIDVEPSETVREVKVKIAQEKGEYEAERMKVI
FT                   YSGKILQDDKTVESYNIQEKDFLVCLPSKQPKAAASTASSQVPSTPAARAPVSTPAAPP
FT                   APHAAAAPPPSVAPATPSPAGAAPAPSSGPAFGDPSALTMGPAAEGAVVQMEAMGFART
FT                   DIDRAMRAAFYNPDRAIEYLLTGIPDNIQEQQQQQQQASETAPTGAAPAAPAAPSGGDE
FT                   PHLNLFEAAAQAGGEGGRPRGAAGAGAGAAGGEALGSLEFLRSNPHFQQLRQLVQQQPH
FT                   MLEPILQQVAAGNPQIASIIGQNSDQFLQLLGEELEDEEGALPPGAQAISVTEEERDAI
FT                   ERLCRLGFPRDSVIQAYFACDKNEELAANFLFDQPDEDEQ"
     MKLTFKDLKQ EKFVIDVEPS ETVREVKVKI AQEKGEYEAE RMKVIYSGKI LQDDKTVESY        60
     NIQEKDFLVC LPSKQPKAAA STASSQVPST PAARAPVSTP AAPPAPHAAA APPPSVAPAT       120
     PSPAGAAPAP SSGPAFGDPS ALTMGPAAEG AVVQMEAMGF ARTDIDRAMR AAFYNPDRAI       180
     EYLLTGIPDN IQEQQQQQQQ ASETAPTGAA PAAPAAPSGG DEPHLNLFEA AAQAGGEGGR       240
     PRGAAGAGAG AAGGEALGSL EFLRSNPHFQ QLRQLVQQQP HMLEPILQQV AAGNPQIASI       300
     IGQNSDQFLQ LLGEELEDEE GALPPGAQAI SVTEEERDAI ERLCRLGFPR DSVIQAYFAC       360
     DKNEELAANF LFDQPDEDEQ                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page