(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE119

PENCW_16.PE119       Location/Qualifiers
FT   CDS             join(273853..274014,274059..274124,274236..274358)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824353"
FT                   /orf_name="Pc20g01190"
FT                   /product="Putative uncharacterized protein Pc20g01190 "
FT                   /protein_id="CAP85448.1"
FT                   /db_xref="UniParc:UPI0001831E49"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH44"
FT                   /transl_table=1
FT                   /translation="MANVFFENGGNRSLTYRHLEGLIATASLLDGRMKLSTFECGWFVC
FT                   GRAWLRFGWAETISAKWVNFYECSVYAHTAQDRWKQSSYNAICVLQCQAVLYCRISKLA
FT                   LEALIRNLVSRE"
     MANVFFENGG NRSLTYRHLE GLIATASLLD GRMKLSTFEC GWFVCGRAWL RFGWAETISA        60
     KWVNFYECSV YAHTAQDRWK QSSYNAICVL QCQAVLYCRI SKLALEALIR NLVSRE           116
//

If you have problems or comments...

PBIL Back to PBIL home page