(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE120

PENCW_16.PE120       Location/Qualifiers
FT   CDS             join(complement(275355..275438),complement(274462..275301))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048593" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947737"
FT                   /orf_name="Pc20g01200"
FT                   /product="Pc20g01200 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85449.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001831E4A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH45"
FT                   /transl_table=1
FT                   /translation="MEIQQSLPLSNPSIYKIDPMAWMRPLSDPHSRDLEGDFPLDGKDF
FT                   DSVTDKTLAILLESAPVLHEFGAIKVVRLSRDLVMKGGGTVLPCEAKTLNLVASRTGIR
FT                   APRVHRSFQVEDDTQYFGTKGYIVMDFIPGQPLDKCWADLTSDNQRQIAIQIAEMIKEM
FT                   QSVVISQPGPPGGGPFRGRFFTDYSAGPFKDSAEFQGWFNHKLDICKHVKQCPKDIPPF
FT                   QFTTFVLTHQDISPRNLILDQNGEVWLVDWAFAGAYPPAFESAALLAQQFFTGFNEAVL
FT                   SLIPRFPEEERQLDSIAYGLTTAALA"
     MEIQQSLPLS NPSIYKIDPM AWMRPLSDPH SRDLEGDFPL DGKDFDSVTD KTLAILLESA        60
     PVLHEFGAIK VVRLSRDLVM KGGGTVLPCE AKTLNLVASR TGIRAPRVHR SFQVEDDTQY       120
     FGTKGYIVMD FIPGQPLDKC WADLTSDNQR QIAIQIAEMI KEMQSVVISQ PGPPGGGPFR       180
     GRFFTDYSAG PFKDSAEFQG WFNHKLDICK HVKQCPKDIP PFQFTTFVLT HQDISPRNLI       240
     LDQNGEVWLV DWAFAGAYPP AFESAALLAQ QFFTGFNEAV LSLIPRFPEE ERQLDSIAYG       300
     LTTAALA                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page