(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE122

PENCW_16.PE122       Location/Qualifiers
FT   CDS             278175..282176
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20671673"
FT                   /orf_name="Pc20g01220"
FT                   /product="Pc20g01220 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP85451.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI0001831E4B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH46"
FT                   /transl_table=1
FT                   /translation="MQQPQEGVTAVEKVADGPQLNEKPVDKRDSDSASTSTAKEHESKT
FT                   PVASDEDALYAHLPEHEKDILKQQLDAPPVNISYFGLYRYASRIDILIIVISTLCAIAA
FT                   GAALPLFTILFGSLATAFQKIMLRTIPYDEFYDQLTTNVLYFIYLGIGEFVTVYVSTVG
FT                   FIYTGEHVTQKIREHYLEAILRQNIAYFDKLGAGEVTTRITADTNLIQDGVSEKVGLTL
FT                   TAVATFVTAFIVAYIKYAPLAGICTSTMVALVLIMGGGSQLIIKFGKLSLESAGAGGTV
FT                   AEEVISSIRNATAFGTQDKLAKQYESHLLRAERWGMRLQMSLAVMVGIMFGLMFMNYGL
FT                   GFWMGSQFLVDGKVDVGQVLTILMAILIGSFSLGNVSPNASAFTNAVAAATKIFATIDR
FT                   DSPLDPTSDEGIILDHVEGHIEFRNVKHIYPSRPEVTVMNDVSLGIPAGNTTALVGPSG
FT                   SGKSTVVGLVERFYLPVGGQVFLDGHDIQTLNLRWLRQQISLVSQEPVLFGTTIYQNIR
FT                   HGLIGTRFEHESEEKIKELIENAAKMANAHEFITALPEGYETNVGQRGFLLSGGQKQRI
FT                   AIARAMVSDPKILLLDEATSALDTKSEGVVQAALDRAAEGRTTIVIAHRLSTIKSAHNI
FT                   VVFVQGSIVEQGTHSQLTEHDGPYFKLVEAQRINEEKDADALDADEDEDGLEEMTKSHI
FT                   ARVKSIASGSTCVKDEAETFQDAMHRQESRKSVSSVILSQKTAEGGRKHSLLTLIKFIG
FT                   SFNKEERWFMAIGLCFSILAGCGQPTQAFLYAKAISALSLPKTQYDKLRSDANFWSLMF
FT                   FIVGIVQIITFSVHGIAFAFSSERLIRKARGNAFRVMLRQDINFFDREENSTGALTSFL
FT                   STETKHLAGISGQTLGTILMTSTTLIASIVIALAFGWKLALVCMSVIPILLGCGFYRFY
FT                   MLAAFQARSKAAYEGSASYACEATSAIRTVASLTRETDVWSFYHGQLERQGRTSLISVF
FT                   KSSLLYAASQALVFFCVALGFWYGGTLLGHHEYDVFRFFVCFSEILFGAQSAGTVFSFS
FT                   PDMGKAKNAAAEFLRLFERRPTIDTWSEEGENLDHCEGTIEFKDVHFRYPTRPEQPVLR
FT                   GLNLTVKPGQYIALVGPSGCGKSTTIALLERFYDALSGGVYIDDKNIADLNVNSYRSHL
FT                   ALVSQEPTLYQGTIKENILLGSPNQDPTEEELVQVCKDANIYDFIMSLPEGFNTVVGSK
FT                   GGMLSGGQKQRVAIARALLRNPKVLLLDEATSALDSESEKVVQAALDAAARGRTTIAVA
FT                   HRLSTIQKADIIYVFDQGKIVESGTHTELLRNKGRYFELVNLQSLGRAG"
     MQQPQEGVTA VEKVADGPQL NEKPVDKRDS DSASTSTAKE HESKTPVASD EDALYAHLPE        60
     HEKDILKQQL DAPPVNISYF GLYRYASRID ILIIVISTLC AIAAGAALPL FTILFGSLAT       120
     AFQKIMLRTI PYDEFYDQLT TNVLYFIYLG IGEFVTVYVS TVGFIYTGEH VTQKIREHYL       180
     EAILRQNIAY FDKLGAGEVT TRITADTNLI QDGVSEKVGL TLTAVATFVT AFIVAYIKYA       240
     PLAGICTSTM VALVLIMGGG SQLIIKFGKL SLESAGAGGT VAEEVISSIR NATAFGTQDK       300
     LAKQYESHLL RAERWGMRLQ MSLAVMVGIM FGLMFMNYGL GFWMGSQFLV DGKVDVGQVL       360
     TILMAILIGS FSLGNVSPNA SAFTNAVAAA TKIFATIDRD SPLDPTSDEG IILDHVEGHI       420
     EFRNVKHIYP SRPEVTVMND VSLGIPAGNT TALVGPSGSG KSTVVGLVER FYLPVGGQVF       480
     LDGHDIQTLN LRWLRQQISL VSQEPVLFGT TIYQNIRHGL IGTRFEHESE EKIKELIENA       540
     AKMANAHEFI TALPEGYETN VGQRGFLLSG GQKQRIAIAR AMVSDPKILL LDEATSALDT       600
     KSEGVVQAAL DRAAEGRTTI VIAHRLSTIK SAHNIVVFVQ GSIVEQGTHS QLTEHDGPYF       660
     KLVEAQRINE EKDADALDAD EDEDGLEEMT KSHIARVKSI ASGSTCVKDE AETFQDAMHR       720
     QESRKSVSSV ILSQKTAEGG RKHSLLTLIK FIGSFNKEER WFMAIGLCFS ILAGCGQPTQ       780
     AFLYAKAISA LSLPKTQYDK LRSDANFWSL MFFIVGIVQI ITFSVHGIAF AFSSERLIRK       840
     ARGNAFRVML RQDINFFDRE ENSTGALTSF LSTETKHLAG ISGQTLGTIL MTSTTLIASI       900
     VIALAFGWKL ALVCMSVIPI LLGCGFYRFY MLAAFQARSK AAYEGSASYA CEATSAIRTV       960
     ASLTRETDVW SFYHGQLERQ GRTSLISVFK SSLLYAASQA LVFFCVALGF WYGGTLLGHH      1020
     EYDVFRFFVC FSEILFGAQS AGTVFSFSPD MGKAKNAAAE FLRLFERRPT IDTWSEEGEN      1080
     LDHCEGTIEF KDVHFRYPTR PEQPVLRGLN LTVKPGQYIA LVGPSGCGKS TTIALLERFY      1140
     DALSGGVYID DKNIADLNVN SYRSHLALVS QEPTLYQGTI KENILLGSPN QDPTEEELVQ      1200
     VCKDANIYDF IMSLPEGFNT VVGSKGGMLS GGQKQRVAIA RALLRNPKVL LLDEATSALD      1260
     SESEKVVQAA LDAAARGRTT IAVAHRLSTI QKADIIYVFD QGKIVESGTH TELLRNKGRY      1320
     FELVNLQSLG RAG                                                         1333
//

If you have problems or comments...

PBIL Back to PBIL home page