(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE123

PENCW_16.PE123       Location/Qualifiers
FT   CDS             join(complement(282940..282987),complement(282785..282870),
FT                   complement(282536..282695))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977582"
FT                   /orf_name="Pc20g01230"
FT                   /product="Pc20g01230 protein"
FT                   /protein_id="CAP85452.1"
FT                   /db_xref="InterPro:IPR010760"
FT                   /db_xref="UniParc:UPI0001831E4C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH47"
FT                   /transl_table=1
FT                   /translation="MDQAKETRSFRDQERVDNLRASIASLEAKYARLEADLASVTAQLK
FT                   DDYNTTCVRYTQLLHEYNDIRDVGQGLMELIADARGVRQVEVVREFGFSEED"
     MDQAKETRSF RDQERVDNLR ASIASLEAKY ARLEADLASV TAQLKDDYNT TCVRYTQLLH        60
     EYNDIRDVGQ GLMELIADAR GVRQVEVVRE FGFSEED                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page