(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE124

PENCW_16.PE124       Location/Qualifiers
FT   CDS             join(283390..283503,283554..283631,283702..284532,
FT                   284598..285041)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172196" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947738"
FT                   /orf_name="Pc20g01240"
FT                   /product="Pc20g01240 protein"
FT                   /protein_id="CAP85453.1"
FT                   /db_xref="InterPro:IPR018825"
FT                   /db_xref="InterPro:IPR018827"
FT                   /db_xref="UniParc:UPI0001831109"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH48"
FT                   /transl_table=1
FT                   /translation="MAYLRQSLWTLSVLVASALAHGGHEAVPEGESISQDPIDSTLWTH
FT                   MILMGLAFGIIFPTGMVLGIIRSRWHVPVQVVGTVIAVLAYFLGHAHKGRQFDKNVHAS
FT                   VANWLMLLLVAQVVLGFYLKLHLEKAGQARIRWIFVLAHGIVGKVMPVLSWAQMLFGGI
FT                   ASLGFCRDDHLGQCLAHFIMGSAFIGYGICLTILLLVGQYWLRRTGRSQEFFDSLIIAA
FT                   WGCVNTFTEHRWGSPWAHNDLQHTTMGIIWWCAGLLGMWLSRTRSGRPKRNLIPAIVIL
FT                   ITGYAMSAHPQSLMISTMIHSIFGYTLMAAGLTRIIEISFVLKDKPALSEPNSFQYLTP
FT                   FLLYASGFLFMGATEEQMLLLHNAGVTHVSYVLILYSIAFIVFLCKLIPYPPLIFSGTP
FT                   THSSLPVVNILLHIYAVHAWPNSESTNQDGPMYSTLNGNANGRARSNSQQIQDAEAFEL
FT                   HGLISDDEEGPSMGPRKNSDEELGKEETRH"
     MAYLRQSLWT LSVLVASALA HGGHEAVPEG ESISQDPIDS TLWTHMILMG LAFGIIFPTG        60
     MVLGIIRSRW HVPVQVVGTV IAVLAYFLGH AHKGRQFDKN VHASVANWLM LLLVAQVVLG       120
     FYLKLHLEKA GQARIRWIFV LAHGIVGKVM PVLSWAQMLF GGIASLGFCR DDHLGQCLAH       180
     FIMGSAFIGY GICLTILLLV GQYWLRRTGR SQEFFDSLII AAWGCVNTFT EHRWGSPWAH       240
     NDLQHTTMGI IWWCAGLLGM WLSRTRSGRP KRNLIPAIVI LITGYAMSAH PQSLMISTMI       300
     HSIFGYTLMA AGLTRIIEIS FVLKDKPALS EPNSFQYLTP FLLYASGFLF MGATEEQMLL       360
     LHNAGVTHVS YVLILYSIAF IVFLCKLIPY PPLIFSGTPT HSSLPVVNIL LHIYAVHAWP       420
     NSESTNQDGP MYSTLNGNAN GRARSNSQQI QDAEAFELHG LISDDEEGPS MGPRKNSDEE       480
     LGKEETRH                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page