(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE125

PENCW_16.PE125       Location/Qualifiers
FT   CDS             join(complement(286663..286702),complement(286557..286614),
FT                   complement(286322..286508),complement(285377..286270))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172217" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947739"
FT                   /orf_name="Pc20g01250"
FT                   /product="Pc20g01250 protein"
FT                   /function="binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAP85454.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000183110A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH49"
FT                   /transl_table=1
FT                   /translation="MAEQQDNAQSISADEIALYDRQIRLWGVHAQEKIRSANILLITVK
FT                   ALANEVAKNLVLAGIGSLTIIDHQDVTEEDLGAQFFIAEAQSEKDVIGKNRAQVAGPQI
FT                   HKMNPRVKLNIDTSDVKTKQPDFFAQFDITIATELDFLTNTTVNAACRLANRPFYAAGL
FT                   HGLYGYVFADLISHDFVIERNKSNMPPATQETPTRSIIDITTKKEQNEANKEESKIIEL
FT                   VTKREVYSPLILANTSPLPEEYTRLPRRRKQVTPLLSCLRALWEFEKLRGHRPTFTHED
FT                   LELFTKLSRDRHQELKLEPLTLDSVFLRTFLQNLGSELSPVAAFLGGALAQDVINVLSA
FT                   REQPLQNMLLFDGEKSVGPIYSLHPFFPDDGADMAAVPPVRNPVTVPVAGDS"
     MAEQQDNAQS ISADEIALYD RQIRLWGVHA QEKIRSANIL LITVKALANE VAKNLVLAGI        60
     GSLTIIDHQD VTEEDLGAQF FIAEAQSEKD VIGKNRAQVA GPQIHKMNPR VKLNIDTSDV       120
     KTKQPDFFAQ FDITIATELD FLTNTTVNAA CRLANRPFYA AGLHGLYGYV FADLISHDFV       180
     IERNKSNMPP ATQETPTRSI IDITTKKEQN EANKEESKII ELVTKREVYS PLILANTSPL       240
     PEEYTRLPRR RKQVTPLLSC LRALWEFEKL RGHRPTFTHE DLELFTKLSR DRHQELKLEP       300
     LTLDSVFLRT FLQNLGSELS PVAAFLGGAL AQDVINVLSA REQPLQNMLL FDGEKSVGPI       360
     YSLHPFFPDD GADMAAVPPV RNPVTVPVAG DS                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page