(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE127

PENCW_16.PE127       Location/Qualifiers
FT   CDS             join(291774..292383,292460..293166)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947741"
FT                   /orf_name="Pc20g01270"
FT                   /product="Pc20g01270 protein"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP85456.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019103"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI000183110C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH51"
FT                   /transl_table=1
FT                   /translation="MRITVSVIRPEQADSDIINLEVGGDMSIELLKAIVESETSIPPEA
FT                   QQLVYNNQLLQNPSQTLDQAGITEGDMLGVHVTLRAPQPAPRPAASSSVAPRQNAQPRP
FT                   GMPDPETIRLHILGDPRVREAVRRQNPELSEAADNAQRFREVLLRQQQGEAQREAEKEA
FT                   RIAMLNADPFNHDNQKEIEEIIRQNAVTENLHNAMEHHPESFGRVTMLYIPVEVNGHRL
FT                   NAFVDSGAQVTIMSPECATSCNIMRLVDRRYGGIAKGVGTAPILGRVHSAQIKIGEMFL
FT                   PCSFTVMEGKQIDLLLGLDMLRRHQACIDLQRGALVIQDQAVPFLGESDIPKHFTEEFE
FT                   AEPTVKGADGAEVGARTGAVTHKAENNPNANATPNIASASGSGASGSQPRINIRPAPTS
FT                   RWPQDSIARITELGFSREEAVRALDMAHGDLEGAIGFLI"
     MRITVSVIRP EQADSDIINL EVGGDMSIEL LKAIVESETS IPPEAQQLVY NNQLLQNPSQ        60
     TLDQAGITEG DMLGVHVTLR APQPAPRPAA SSSVAPRQNA QPRPGMPDPE TIRLHILGDP       120
     RVREAVRRQN PELSEAADNA QRFREVLLRQ QQGEAQREAE KEARIAMLNA DPFNHDNQKE       180
     IEEIIRQNAV TENLHNAMEH HPESFGRVTM LYIPVEVNGH RLNAFVDSGA QVTIMSPECA       240
     TSCNIMRLVD RRYGGIAKGV GTAPILGRVH SAQIKIGEMF LPCSFTVMEG KQIDLLLGLD       300
     MLRRHQACID LQRGALVIQD QAVPFLGESD IPKHFTEEFE AEPTVKGADG AEVGARTGAV       360
     THKAENNPNA NATPNIASAS GSGASGSQPR INIRPAPTSR WPQDSIARIT ELGFSREEAV       420
     RALDMAHGDL EGAIGFLI                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page