(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE128

PENCW_16.PE128       Location/Qualifiers
FT   CDS             join(complement(294226..294298),complement(293958..294149),
FT                   complement(293524..293676),complement(293362..293432))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181224" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947742"
FT                   /orf_name="Pc20g01280"
FT                   /product="Pc20g01280 protein"
FT                   /protein_id="CAP85457.1"
FT                   /db_xref="InterPro:IPR016964"
FT                   /db_xref="UniParc:UPI000183110D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH52"
FT                   /transl_table=1
FT                   /translation="MSICTRKRDLAYLLFFVTHVPIILLIDTVPLLPSFLQTNLSHQLR
FT                   EFYITTYRDKFFEDPPTWFTVFIWMELLYHLPVSIWAARGLLKDHPLVPVHLLVFGIQA
FT                   FITTLTSLVVVWSWTDRSVAEKQQLTTLYAPYMALGGFMALDMVFRLRDKLMPKTKRE"
     MSICTRKRDL AYLLFFVTHV PIILLIDTVP LLPSFLQTNL SHQLREFYIT TYRDKFFEDP        60
     PTWFTVFIWM ELLYHLPVSI WAARGLLKDH PLVPVHLLVF GIQAFITTLT SLVVVWSWTD       120
     RSVAEKQQLT TLYAPYMALG GFMALDMVFR LRDKLMPKTK RE                          162
//

If you have problems or comments...

PBIL Back to PBIL home page