(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE131

PENCW_16.PE131       Location/Qualifiers
FT   CDS             join(301664..301803,301856..302255)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181202" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824355"
FT                   /orf_name="Pc20g01310"
FT                   /product="Pc20g01310 protein"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /biological_process="translation"
FT                   /protein_id="CAP85460.1"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="UniParc:UPI0001831110"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD68"
FT                   /transl_table=1
FT                   /translation="MFQSIRFSSRLPARLVRWNSTGPALPPLMATLRTDLKTAMRAKDT
FT                   TRLNVLRALISETNNAAKTASPIQTDIQLLSLIRKRLNASKDAAKEFAAAERPDLKEKE
FT                   DAQVVVLEEYASQVKTLPIAEIKEVVINEIAAMVNANTKPNQGTVLKALFAPGGPLDGK
FT                   PVDRKEVATEVKNALS"
     MFQSIRFSSR LPARLVRWNS TGPALPPLMA TLRTDLKTAM RAKDTTRLNV LRALISETNN        60
     AAKTASPIQT DIQLLSLIRK RLNASKDAAK EFAAAERPDL KEKEDAQVVV LEEYASQVKT       120
     LPIAEIKEVV INEIAAMVNA NTKPNQGTVL KALFAPGGPL DGKPVDRKEV ATEVKNALS        179
//

If you have problems or comments...

PBIL Back to PBIL home page