(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE132

PENCW_16.PE132       Location/Qualifiers
FT   CDS             join(complement(303117..303218),complement(302942..303056),
FT                   complement(302712..302890),complement(302378..302665))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671674"
FT                   /orf_name="Pc20g01320"
FT                   /product="Pc20g01320 protein"
FT                   /protein_id="CAP85461.1"
FT                   /db_xref="InterPro:IPR019623"
FT                   /db_xref="UniParc:UPI0001831111"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD69"
FT                   /transl_table=1
FT                   /translation="MFLIWGLLVTAALANANDLVGTWTTKSRDVLTGPGFYDPLNDKLL
FT                   EPNLTGISYSFDDDGNYESAYYRAISNPVDPSCPGGIMQWQHGSYTVFGNGTLILTPIA
FT                   VDGRQLLSDPCRQQSGQYTRYNTTEEFKEFSVYIDKFNRIKRLDLTKFDGSLVHPMFLA
FT                   YQPPKMLPTTTLNPMPTGHKQKRELSSKESGVYLVAREQLVNPDRWWWLGVLMTSLGGV
FT                   AFFCS"
     MFLIWGLLVT AALANANDLV GTWTTKSRDV LTGPGFYDPL NDKLLEPNLT GISYSFDDDG        60
     NYESAYYRAI SNPVDPSCPG GIMQWQHGSY TVFGNGTLIL TPIAVDGRQL LSDPCRQQSG       120
     QYTRYNTTEE FKEFSVYIDK FNRIKRLDLT KFDGSLVHPM FLAYQPPKML PTTTLNPMPT       180
     GHKQKRELSS KESGVYLVAR EQLVNPDRWW WLGVLMTSLG GVAFFCS                     227
//

If you have problems or comments...

PBIL Back to PBIL home page