(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE133

PENCW_16.PE133       Location/Qualifiers
FT   CDS             join(303541..303628,303678..304103,304155..304270)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000007299" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947744"
FT                   /orf_name="Pc20g01330"
FT                   /product="Pc20g01330 protein"
FT                   /function="5-formyltetrahydrofolate cyclo-ligase activity "
FT                   /function="ATP binding"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="CAP85462.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="GO:0030272"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="UniParc:UPI0001831112"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD70"
FT                   /transl_table=1
FT                   /translation="MAFQAAKRDLRKRMRSTLQGLSATSISQQSSAATTTFLSLPEYQT
FT                   AKSIAVYLSMPSGELSTTGIVKDALQRGKNVYIPYIHTQGKTSIMDMFALGSVSEFESL
FT                   QRDKWGIPSLLSTQIEGRPNGLAQGLDLIVMPGMAFDHGFRRLGHGKGYYDHFLTRYST
FT                   STHKMPFLVALSLQEQLLAEDIPVVEHDWLVDAIVVGDGQFLNRRA"
     MAFQAAKRDL RKRMRSTLQG LSATSISQQS SAATTTFLSL PEYQTAKSIA VYLSMPSGEL        60
     STTGIVKDAL QRGKNVYIPY IHTQGKTSIM DMFALGSVSE FESLQRDKWG IPSLLSTQIE       120
     GRPNGLAQGL DLIVMPGMAF DHGFRRLGHG KGYYDHFLTR YSTSTHKMPF LVALSLQEQL       180
     LAEDIPVVEH DWLVDAIVVG DGQFLNRRA                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page