(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE134

PENCW_16.PE134       Location/Qualifiers
FT   CDS             join(complement(304818..304863),complement(304556..304671),
FT                   complement(304408..304498),complement(304304..304353))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223543" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947745"
FT                   /orf_name="Pc20g01340"
FT                   /product="Pc20g01340 protein"
FT                   /protein_id="CAP85463.1"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI0001831113"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD71"
FT                   /transl_table=1
FT                   /translation="MYQHLTAETGSKRGSSRKTLLAPIHFIFSLLQKRSTVSIWLYEQL
FT                   AFRIEGKIRGFDEFMNLVIDDAVEVRLATKTEEEKRRPLGQILLKGDNVSLIQAV"
     MYQHLTAETG SKRGSSRKTL LAPIHFIFSL LQKRSTVSIW LYEQLAFRIE GKIRGFDEFM        60
     NLVIDDAVEV RLATKTEEEK RRPLGQILLK GDNVSLIQAV                             100
//

If you have problems or comments...

PBIL Back to PBIL home page