(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE136

PENCW_16.PE136       Location/Qualifiers
FT   CDS             308776..311103
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181179" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947746"
FT                   /orf_name="Pc20g01360"
FT                   /product="Pc20g01360 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85465.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI0001831115"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD73"
FT                   /transl_table=1
FT                   /translation="MEIDGQPSKRRRRSRKVQSDRKFECTFEGCGKSYSRAEHLSRHAL
FT                   NHTPKQIYRCDFPNCYRSFVRQDLCTRHRERHTTSGSQLQKRDHFTENGTKHSPPSSPA
FT                   ITAPEYFVGSEEPKPPVTTYPLTTGVDSNEIQVDQFSDFPAVLDQPDNLIDLDSMSYPI
FT                   FGGETYNRSPFAMADDFAAWLFSEPVAPLGYGMVPLVQNQFYMNEPAYSNHNFCSVIPQ
FT                   HPMSVTSILDSGAPPAVISEAKRQELLHLMSTRFNESAYAAGAKRKDALMDGDLNDDRH
FT                   ALSLRMMQTYIGSYWYHFHAQLPILHQPTFSADRIPNLLLLAIMAIGAATLDKIHGQSA
FT                   TEAAAELASFIAWHLRWEIFMDADFRPPAKLWVFQSLLLLEVYEKLFSTRALHERAHIH
FT                   HDTTLTLMRRGSSLIGSSSFATPESKEEDESWSTWIKTEATRRVAFAAFVLDSTHATMF
FT                   GHSAKMVAHELRLPLPCDEALWAATSAAEVARVQSSLQSHGVRPIMFLDGLKRTLNGQP
FT                   VRTNAFGRIIIMSGLLSVCWHLNQRDLQISSLGVGQTLGGRDKWRTALLRAFDNWRRDF
FT                   DEALGPSTTSESRNVLHGLAHMGSHVDIADLQIFAGAGRLMGRSITARDYSAAREKTEK
FT                   WATKASARDATFYALKFLSTCFLDSATQPGEYAARDDYLLNRPWVMYFAALVVWTYGFA
FT                   LDGPLRPPPILLTVADRERDMQGFLHRVGEIQEPNELEAMNGRNGCLGLLMILRDSFAK
FT                   PRWELLGEAARLLDSCIAKLQS"
     MEIDGQPSKR RRRSRKVQSD RKFECTFEGC GKSYSRAEHL SRHALNHTPK QIYRCDFPNC        60
     YRSFVRQDLC TRHRERHTTS GSQLQKRDHF TENGTKHSPP SSPAITAPEY FVGSEEPKPP       120
     VTTYPLTTGV DSNEIQVDQF SDFPAVLDQP DNLIDLDSMS YPIFGGETYN RSPFAMADDF       180
     AAWLFSEPVA PLGYGMVPLV QNQFYMNEPA YSNHNFCSVI PQHPMSVTSI LDSGAPPAVI       240
     SEAKRQELLH LMSTRFNESA YAAGAKRKDA LMDGDLNDDR HALSLRMMQT YIGSYWYHFH       300
     AQLPILHQPT FSADRIPNLL LLAIMAIGAA TLDKIHGQSA TEAAAELASF IAWHLRWEIF       360
     MDADFRPPAK LWVFQSLLLL EVYEKLFSTR ALHERAHIHH DTTLTLMRRG SSLIGSSSFA       420
     TPESKEEDES WSTWIKTEAT RRVAFAAFVL DSTHATMFGH SAKMVAHELR LPLPCDEALW       480
     AATSAAEVAR VQSSLQSHGV RPIMFLDGLK RTLNGQPVRT NAFGRIIIMS GLLSVCWHLN       540
     QRDLQISSLG VGQTLGGRDK WRTALLRAFD NWRRDFDEAL GPSTTSESRN VLHGLAHMGS       600
     HVDIADLQIF AGAGRLMGRS ITARDYSAAR EKTEKWATKA SARDATFYAL KFLSTCFLDS       660
     ATQPGEYAAR DDYLLNRPWV MYFAALVVWT YGFALDGPLR PPPILLTVAD RERDMQGFLH       720
     RVGEIQEPNE LEAMNGRNGC LGLLMILRDS FAKPRWELLG EAARLLDSCI AKLQS            775
//

If you have problems or comments...

PBIL Back to PBIL home page