(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE137

PENCW_16.PE137       Location/Qualifiers
FT   CDS             join(311500..311671,311771..311911,311982..312074,
FT                   312140..312168)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824357"
FT                   /orf_name="Pc20g01370"
FT                   /product="Pc20g01370 protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAP85466.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI0001831116"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD74"
FT                   /transl_table=1
FT                   /translation="MANNDQASTNYKEAFSLFDRRGTGRVAGDLLGDLLRACGQNPTLA
FT                   EISDLEKSVGGDFDFDSFLKVLNRPGGFREPGEPEEYCRGFQVFDKDMTGFIGVGQLRY
FT                   ILTNLGEKMSDDEVDELLKAVDTSSGEINYTDLVRTILAN"
     MANNDQASTN YKEAFSLFDR RGTGRVAGDL LGDLLRACGQ NPTLAEISDL EKSVGGDFDF        60
     DSFLKVLNRP GGFREPGEPE EYCRGFQVFD KDMTGFIGVG QLRYILTNLG EKMSDDEVDE       120
     LLKAVDTSSG EINYTDLVRT ILAN                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page