(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE138

PENCW_16.PE138       Location/Qualifiers
FT   CDS             complement(312375..312908)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181168" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947747"
FT                   /orf_name="Pc20g01380"
FT                   /product="Pc20g01380 protein"
FT                   /protein_id="CAP85467.1"
FT                   /db_xref="UniParc:UPI00018311E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD75"
FT                   /transl_table=1
FT                   /translation="MTDQRLPIQTQHCRFCNHLLLATTRNINTLPRRGGESKDKALILP
FT                   LERKSSADGEVEVDLEEEARATETPSRKARHASNHTTLLLATTIPDRRATMIRREDGIE
FT                   KRILLRCGRCKVVVGYYLDRVHWAAGDRGAVRDGEEEDEERPPAVYLLPGAVVETEKLG
FT                   GEGVGEREWREWAV"
     MTDQRLPIQT QHCRFCNHLL LATTRNINTL PRRGGESKDK ALILPLERKS SADGEVEVDL        60
     EEEARATETP SRKARHASNH TTLLLATTIP DRRATMIRRE DGIEKRILLR CGRCKVVVGY       120
     YLDRVHWAAG DRGAVRDGEE EDEERPPAVY LLPGAVVETE KLGGEGVGER EWREWAV          177
//

If you have problems or comments...

PBIL Back to PBIL home page