(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE139

PENCW_16.PE139       Location/Qualifiers
FT   CDS             join(complement(313732..315686),complement(313469..313661))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000245985" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947748"
FT                   /orf_name="Pc20g01390"
FT                   /product="Pc20g01390 protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP85468.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="UniParc:UPI00018311E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD76"
FT                   /transl_table=1
FT                   /translation="MAPAHLRAPPQAPPIFTATPQSVVADAERLIKNSRAIQDKVVAEI
FT                   KPDDATFANVVRPLAQDDNQMGLESHILGFYQAVSTDSKLRDASSKAEELMDEFFIEAV
FT                   MREDVFGLVDAVLRRNESLDPESRRLLEKEHKDFVRNGLGLPAGPQRLRFKEIKKRLSQ
FT                   LSIEFQKNLNEENGGIWFTPEQLAGVPKDVLDGLKKGEGENAGKLWLSFKYPDLFPTMK
FT                   YASDPETRRQVMIANENKCNQNVPLFRESIILRDEAARLIGYPNHAAFRIEDKMAKTPE
FT                   IVNKFLGDLRDRLTDGGKKEIQKLLELKNATDPKADGRYYLWDHRFYDRLMLEKDYSLD
FT                   QQLIAEWFPLQTTIDGMLKIFEELFGLEFVEIIGEDRAAIAPTGKGNDIVWHDDVQVFS
FT                   VWNDEGEGSGFVGYLYLDLFPREGKYGHAANFNLQPGFVDKDGNRRFPATALVCNFTKP
FT                   QPKKPSLLKHDEVVTLFHELGHGIHDLVSRTIYSRFHGTSTVRDFVEAPSQMLENWCWE
FT                   PSQLRSLSRHYSTLSPEYLATWQEAQEGKTATSQPSERIPDDVIENLIRTKHVNDSLFN
FT                   LRQLHFGIFDMTVHEPKTHADIEALPLSATYNRLRQEITQLDGPEVQGAGSEWGHGEAT
FT                   FGHLIGGYDAGYYGYLSSQVYSTDMFYTVFKDDPMNKAAGRRYRYQVLEKGGSQDEMKT
FT                   LTEFLGREPQTDAFYKDLGLA"
     MAPAHLRAPP QAPPIFTATP QSVVADAERL IKNSRAIQDK VVAEIKPDDA TFANVVRPLA        60
     QDDNQMGLES HILGFYQAVS TDSKLRDASS KAEELMDEFF IEAVMREDVF GLVDAVLRRN       120
     ESLDPESRRL LEKEHKDFVR NGLGLPAGPQ RLRFKEIKKR LSQLSIEFQK NLNEENGGIW       180
     FTPEQLAGVP KDVLDGLKKG EGENAGKLWL SFKYPDLFPT MKYASDPETR RQVMIANENK       240
     CNQNVPLFRE SIILRDEAAR LIGYPNHAAF RIEDKMAKTP EIVNKFLGDL RDRLTDGGKK       300
     EIQKLLELKN ATDPKADGRY YLWDHRFYDR LMLEKDYSLD QQLIAEWFPL QTTIDGMLKI       360
     FEELFGLEFV EIIGEDRAAI APTGKGNDIV WHDDVQVFSV WNDEGEGSGF VGYLYLDLFP       420
     REGKYGHAAN FNLQPGFVDK DGNRRFPATA LVCNFTKPQP KKPSLLKHDE VVTLFHELGH       480
     GIHDLVSRTI YSRFHGTSTV RDFVEAPSQM LENWCWEPSQ LRSLSRHYST LSPEYLATWQ       540
     EAQEGKTATS QPSERIPDDV IENLIRTKHV NDSLFNLRQL HFGIFDMTVH EPKTHADIEA       600
     LPLSATYNRL RQEITQLDGP EVQGAGSEWG HGEATFGHLI GGYDAGYYGY LSSQVYSTDM       660
     FYTVFKDDPM NKAAGRRYRY QVLEKGGSQD EMKTLTEFLG REPQTDAFYK DLGLA            715
//

If you have problems or comments...

PBIL Back to PBIL home page