(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE14

PENCW_16.PE14        Location/Qualifiers
FT   CDS             join(complement(38979..39041),complement(38190..38912),
FT                   complement(38044..38124),complement(37688..37991),
FT                   complement(37466..37639),complement(37330..37416),
FT                   complement(36808..37276),complement(36401..36752))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000271637" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671387"
FT                   /orf_name="Pc20g00140"
FT                   /product="Pc20g00140 protein"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="CAP85343.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI0001831833"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF25"
FT                   /transl_table=1
FT                   /translation="MESELQSQIPGLDHIITEYSVGYLTHAANLYVDDACAESPLTEAA
FT                   ESVTELLVSASGDFSPQNYEAIGNLVTRFITTLSSSDGDPERRQMPFKAKKLEQTINVG
FT                   AQRNMSSTLGLTGNTVDLESANARKMESKVDKKKLEKAERKIRAKQDKKSMKNVTYEAS
FT                   RLLNQPDEAMSYEEFFMAVNPLQMGSDSQAKSKDIKLDNIDISISGLRILTDAAFTLAY
FT                   GRRYGLVGQNGIGKSTLLRALSRREIPIPTHVSILHVEQEITGDDTPALQAVLDADVWR
FT                   KHLLSEQAKISEQLAAIEEERSSLADTSKDAARLDEQREGLDITLSDIYGKLSEMESDK
FT                   AESRAASILAGLGFSQERQQYATKTFSGGWRMRLSLARALFCEPDLLLLDEPSNMLDVP
FT                   SITFLSNYLQGYPSTVLVVSHDRAFLNEVATDIIHQHSERLDYYRGANFESFYATKEER
FT                   RKTAKREYEKQMGERAHLQAFIDKFRYNAAKSSEAQSRIKKLERMPVLEAPEAEYTVHF
FT                   AFPGVEKLSPPIVQMSDVCFGYTKDKPLLRDVDLDVQLDSRIGIVGPNGAGKTTVLKLL
FT                   TNQLEPTSGLISTNSRLRIGFFAQHHVDALDMTTSAVGFMTKTYPGKTDEEYRRHLGAF
FT                   GITGTTGLQRMELLSGGQKSRVAFACLSLTNPHILVLDEPSNHLDIEGMDALSDALRVF
FT                   EGGVVMVSHDVTMLQNVCTSLWVCDGGTVHKFDGTVNAYKKKIAAQADAAGVVAKH"
     MESELQSQIP GLDHIITEYS VGYLTHAANL YVDDACAESP LTEAAESVTE LLVSASGDFS        60
     PQNYEAIGNL VTRFITTLSS SDGDPERRQM PFKAKKLEQT INVGAQRNMS STLGLTGNTV       120
     DLESANARKM ESKVDKKKLE KAERKIRAKQ DKKSMKNVTY EASRLLNQPD EAMSYEEFFM       180
     AVNPLQMGSD SQAKSKDIKL DNIDISISGL RILTDAAFTL AYGRRYGLVG QNGIGKSTLL       240
     RALSRREIPI PTHVSILHVE QEITGDDTPA LQAVLDADVW RKHLLSEQAK ISEQLAAIEE       300
     ERSSLADTSK DAARLDEQRE GLDITLSDIY GKLSEMESDK AESRAASILA GLGFSQERQQ       360
     YATKTFSGGW RMRLSLARAL FCEPDLLLLD EPSNMLDVPS ITFLSNYLQG YPSTVLVVSH       420
     DRAFLNEVAT DIIHQHSERL DYYRGANFES FYATKEERRK TAKREYEKQM GERAHLQAFI       480
     DKFRYNAAKS SEAQSRIKKL ERMPVLEAPE AEYTVHFAFP GVEKLSPPIV QMSDVCFGYT       540
     KDKPLLRDVD LDVQLDSRIG IVGPNGAGKT TVLKLLTNQL EPTSGLISTN SRLRIGFFAQ       600
     HHVDALDMTT SAVGFMTKTY PGKTDEEYRR HLGAFGITGT TGLQRMELLS GGQKSRVAFA       660
     CLSLTNPHIL VLDEPSNHLD IEGMDALSDA LRVFEGGVVM VSHDVTMLQN VCTSLWVCDG       720
     GTVHKFDGTV NAYKKKIAAQ ADAAGVVAKH                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page