(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE140

PENCW_16.PE140       Location/Qualifiers
FT   CDS             join(complement(317693..317930),complement(316506..317635))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000270353" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947749"
FT                   /orf_name="Pc20g01400"
FT                   /product="Pc20g01400 protein"
FT                   /EC_number="1.14.19.1"
FT                   /function="heme binding"
FT                   /function="stearoyl-CoA 9-desaturase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP85469.1"
FT                   /db_xref="GO:0004768"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001522"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR009160"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI00018311EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD77"
FT                   /transl_table=1
FT                   /translation="MSSKPDATRPRAADTKKVHIADTQMTRQNWYKHVNWLNVTFIIGV
FT                   PISGCIQAFFVPLQLKTAIWAVIYYFFTGLGITAGYHRLWAHCSYSATLPMRIWLALVG
FT                   GGAVEGSIRWWARDHRAHHRYTDTDKDPYSVRKGLLYSHLGWMVMKQNPKRIGRTDITD
FT                   LNEDPVVVWQHRNYIKVVITMGLIVPMLVAGLGWGDWYGGFVYAGILRIFFVQQATFCV
FT                   NSLAHWLGDQPFDDRNSPRDHIITALVTLGEGYHNFHHEFPSDYRNAIEWHQYDPTKWT
FT                   IWTCKQLGLAYDLKQFRSNEIEKGRVQQLQKKIDQKRAKLDWGTPLDQLPVMEWDDYVE
FT                   QAKNGRGLISIAGVVHDVTDFIKDHPGGKAMIKSGLGKDATAMFNGGVYYHSNGAHNLL
FT                   STMRVGVIRGGGEVEIWKRAQKENSEYVRDETGQRIIRAGQQVTKMPEPIPTADAA"
     MSSKPDATRP RAADTKKVHI ADTQMTRQNW YKHVNWLNVT FIIGVPISGC IQAFFVPLQL        60
     KTAIWAVIYY FFTGLGITAG YHRLWAHCSY SATLPMRIWL ALVGGGAVEG SIRWWARDHR       120
     AHHRYTDTDK DPYSVRKGLL YSHLGWMVMK QNPKRIGRTD ITDLNEDPVV VWQHRNYIKV       180
     VITMGLIVPM LVAGLGWGDW YGGFVYAGIL RIFFVQQATF CVNSLAHWLG DQPFDDRNSP       240
     RDHIITALVT LGEGYHNFHH EFPSDYRNAI EWHQYDPTKW TIWTCKQLGL AYDLKQFRSN       300
     EIEKGRVQQL QKKIDQKRAK LDWGTPLDQL PVMEWDDYVE QAKNGRGLIS IAGVVHDVTD       360
     FIKDHPGGKA MIKSGLGKDA TAMFNGGVYY HSNGAHNLLS TMRVGVIRGG GEVEIWKRAQ       420
     KENSEYVRDE TGQRIIRAGQ QVTKMPEPIP TADAA                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page