(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE143

PENCW_16.PE143       Location/Qualifiers
FT   CDS             complement(321911..322465)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234926" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947752"
FT                   /orf_name="Pc20g01430"
FT                   /product="Pc20g01430 protein"
FT                   /protein_id="CAP85472.1"
FT                   /db_xref="UniParc:UPI00018311ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD80"
FT                   /transl_table=1
FT                   /translation="MSEPISRTEARQKSADIKKKQAETLAGLPPGSLHISLYIRSDPPL
FT                   PNDFHWAFYLHNGTSSTPGGTKYHARGVGGGWIAGHEATAGIFTENFLCVVIQIATIPP
FT                   SAHERVDEIMRSYDGSLNSIPGITCRVWILTILRILVDEGFVHCDIGELEKDCFEFGNE
FT                   HSATASANQQPRPVVKSRVSS"
     MSEPISRTEA RQKSADIKKK QAETLAGLPP GSLHISLYIR SDPPLPNDFH WAFYLHNGTS        60
     STPGGTKYHA RGVGGGWIAG HEATAGIFTE NFLCVVIQIA TIPPSAHERV DEIMRSYDGS       120
     LNSIPGITCR VWILTILRIL VDEGFVHCDI GELEKDCFEF GNEHSATASA NQQPRPVVKS       180
     RVSS                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page