(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE147

PENCW_16.PE147       Location/Qualifiers
FT   CDS             join(complement(328726..328769),complement(328650..328669),
FT                   complement(328548..328598),complement(327895..328491),
FT                   complement(327687..327805))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977584"
FT                   /orf_name="Pc20g01470"
FT                   /product="Pc20g01470 protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="CAP85476.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI00018311F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD84"
FT                   /transl_table=1
FT                   /translation="MADRYSFSLTTFSPSGKLVQIEYALNAVNQGVTALGIKATNGIVL
FT                   ATEKKSSSPLIDPPSLSKISLITPDIGMVYAGMGPDYRVLVDKARKVSHTGYKRIYNEY
FT                   PPTRILVQDVARVVQEATQSGGVRPYGVSLLVAGWDEGVEPESEEAKKDDPEEKISSKT
FT                   GGIKKGGPSLYQVDPSGSYYPWKATAIGKHATSAKTFLEKRYTEGLELEDAIHIALLTL
FT                   KETIEGEMNGDTIEIGIVGPPADHLLGYEGVEGAQGPRFRKLTKEQIEDYLTNL"
     MADRYSFSLT TFSPSGKLVQ IEYALNAVNQ GVTALGIKAT NGIVLATEKK SSSPLIDPPS        60
     LSKISLITPD IGMVYAGMGP DYRVLVDKAR KVSHTGYKRI YNEYPPTRIL VQDVARVVQE       120
     ATQSGGVRPY GVSLLVAGWD EGVEPESEEA KKDDPEEKIS SKTGGIKKGG PSLYQVDPSG       180
     SYYPWKATAI GKHATSAKTF LEKRYTEGLE LEDAIHIALL TLKETIEGEM NGDTIEIGIV       240
     GPPADHLLGY EGVEGAQGPR FRKLTKEQIE DYLTNL                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page