(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE148

PENCW_16.PE148       Location/Qualifiers
FT   CDS             join(328803..328985,329059..329673,329724..329864)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181124" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977585"
FT                   /orf_name="Pc20g01480"
FT                   /product="Pc20g01480 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85477.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00018311F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD85"
FT                   /transl_table=1
FT                   /translation="MERSKEGELCCRQRWVTFGAVELTKGGDQIGISRGVWDTFGFSAF
FT                   LLLVVLFFFNPSKKETHYPPRVCRICLESVLPTFQPSEFLQKPRVVYESSDPECGRLLS
FT                   PCQCKGSSRYVHEGCLQSWRHADPKYGTRNFWQCPTCGFQYRLERLTWARWISSATTQL
FT                   ILTLGILFLTVFLLGFIADPIIDFYLGPVDVYAELVEEDVSWLGHFLKGLASLGLLSFL
FT                   KAIFALSPFPWNLRSVASGRNSGRNRAAQLNWLVVMVGIGTFLWAVYKGVRSWSRRTLE
FT                   KAGERVMDVPLPDDESDTDVPIPDDAGMKEE"
     MERSKEGELC CRQRWVTFGA VELTKGGDQI GISRGVWDTF GFSAFLLLVV LFFFNPSKKE        60
     THYPPRVCRI CLESVLPTFQ PSEFLQKPRV VYESSDPECG RLLSPCQCKG SSRYVHEGCL       120
     QSWRHADPKY GTRNFWQCPT CGFQYRLERL TWARWISSAT TQLILTLGIL FLTVFLLGFI       180
     ADPIIDFYLG PVDVYAELVE EDVSWLGHFL KGLASLGLLS FLKAIFALSP FPWNLRSVAS       240
     GRNSGRNRAA QLNWLVVMVG IGTFLWAVYK GVRSWSRRTL EKAGERVMDV PLPDDESDTD       300
     VPIPDDAGMK EE                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page